Recombinant Human Carbonic anhydrase-related protein(CA8)

Code CSB-EP004379HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P35219
Relevance Does not have a carbonic anhydrase catalytic activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Carbonic anhydrase VIII
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Research Area Cancer
Source E.coli
Gene Names CA8
Protein Names Recommended name: Carbonic anhydrase-related protein Short name= CARP Alternative name(s): Carbonic anhydrase VIII Short name= CA-VIII
Expression Region 1-290aa
Tag Info N-terminal GST-tagged
Mol. Weight 60.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Does not have a carbonic anhydrase catalytic activity.
Involvement in disease Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)
Protein Families Alpha-carbonic anhydrase family
Database Links

HGNC: 1382

OMIM: 114815

KEGG: hsa:767

STRING: 9606.ENSP00000314407

UniGene: Hs.654388

Related Products

CA8 Antibodies

CA8 Antibodies for Homo sapiens (Human)

CA8 Antibodies for Human

CA8 Proteins

CA8 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.