Recombinant Human Cytokine receptor common subunit gamma(IL2RG),partial (Active)

In Stock
Code CSB-MP011651HU4
Abbreviation Recombinant Human IL2RG protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human IL2RG at 2 μg/ml can bind Anti-IL2RG recombinant antibody (CSB-RA011651MA1HU). The EC50 is 12.19-13.63 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL2RG at 2 μg/mL can bind Anti-IL2RG recombinant antibody (CSB-RA011651MA1HU). The EC50 is 12.19-13.63 ng/mL.
Target Names
Uniprot No.
Alternative Names
Interleukin-2 receptor subunit gamma (IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG); gammaC; p64; CD132
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-254aa
Target Protein Sequence
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Mol. Weight
28.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The common gamma chain (γc) is shared by receptors for IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21, making it a central node in lymphocyte signaling and a target for therapeutic antibody development. This mammalian-expressed construct spanning residues 23–254 captures the extracellular domain responsible for cytokine receptor assembly and provides the native glycosylation patterns required for physiologically relevant binding interactions. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 12.19–13.63 ng/mL, confirming that the folded protein retains epitopes recognized by therapeutic-grade reagents and supports applications in blocking antibody screening, epitope mapping, and competitive inhibition assays for IL2RG-targeting biologics. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in SPR-based affinity characterization and high-throughput drug discovery campaigns focused on modulating γc-dependent immune pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Gene References into Functions
  1. This study identifies one novel mutation in the IL2RG gene and another, previously described mutation in the CYBB genes. It is the first report establishing a diagnosis of X-SCID and X-CGD using WES in Chinese patients. PMID: 29388853
  2. New insights of common gamma chain in hematological malignancies. PMID: 26748725
  3. this study shows that downregulation of miR-3940-5p promotes T-cell activity by targeting the cytokine receptor IL-2R gamma on human cutaneous T-cell lines PMID: 27502164
  4. systematic scoping review highlights the many potential uses of soluble interleukin-2 receptor measurement in the diagnosis and treatment of hemophagocytic syndromes. PMID: 28497365
  5. A deletion mutation in IL2RG gene results in X-linked severe combined immunodeficiency with an atypical phenotype PMID: 27566612
  6. novel missense mutation in Japanese patient results in atypical X-linked severe combined immunodeficiency with the presence of T cells and NK cells and revertant somatic mosaicism PMID: 26407811
  7. reversion of mutation in common lymphoid progenitor results in mild phenotype of SCID PMID: 26076747
  8. High IL2RG expression is associated with Sezary syndrome. PMID: 26551670
  9. Identification of a gammaC splice isoform revealed expression of soluble gammaC proteins (sgammaC). sgammaC directly interacted with surface IL-2Rbeta to suppress IL-2 signaling and to promote pro-inflammatory Th17 cell differentiation. [review] PMID: 26468051
  10. Study show the detection of IL2RG mutations in 2 families with X-SCID and identified 2 novel mutations, confirming the X-SCID pedigrees. PMID: 26125817
  11. Interleukin 2 receptor subunit gamma mutation is associated with X-linked severe combined immunodeficiency. PMID: 26409833
  12. Targeting the binding interface on a shared receptor subunit of a cytokine family enables the inhibition of multiple member cytokines with selectable target spectrum. PMID: 26183780
  13. Results demonstrate that IL2Rgamma has an onogenic role in JAK3-mutation-positive leukemias. PMID: 25109334
  14. findings suggest that over-expression of the IL2RG gene may be implicated in altered immune response in schizophrenia and contribute to the pathomechanisms of this disorder PMID: 24713359
  15. this is the first report on a de novo mutation in the IL2RG gene in a patient born after IVF PMID: 23790094
  16. In a patient with a novel IL2RG mutation, gene-reverted CD8+ T cells accumulate over time. PMID: 23403317
  17. in humans, signaling through the gammac pathway is not required for prethymic lymphoid commitment or for DNA rearrangement. PMID: 24771849
  18. we presented here a novel IL-2Rgammac mutation in a carrier and SCID patient presenting NK cells in the peripheral blood PMID: 23940110
  19. Massively parallel sequencing reveals maternal somatic IL2RG mosaicism in an X-linked severe combined immunodeficiency family. PMID: 23683512
  20. Tax-specific cytotoxic T-lymphocyte cell treatment significantly decreases human soluble IL-2Rgamma serum concentrations and prolongation of survival time in a mouse model of adult T cell leukemia/lymphoma. PMID: 23733874
  21. analysis of multiorgan metastasis of human HER-2+ breast cancer in Rag2-/-;Il2rg-/- mice and treatment with PI3K inhibitor PMID: 22737248
  22. These data highlight the central role of IL-15 and gammac-receptor signaling in renal homeostasis. PMID: 22363690
  23. the amount of the gamma-chain transducing element is able to influence the transcription of genes involved in cell cycle progression, thus being directly involved in the regulatory control of cell proliferation of malignant hematopoietic cell PMID: 22223761
  24. Data imply that IL-21-mediated signaling is critical for long-lived humoral immunity and to restore antibody responses in IL2RG/JAK3-deficient patients after hematopoietic cell transplantation. PMID: 22039266
  25. We report a novel X-CID family with a unique mutation in the extracellular part of CD132 with almost normal T-cell counts but defective memory induction PMID: 21831415
  26. IL-2R common gamma-chain is epigenetically silenced by nucleophosphin-anaplastic lymphoma kinase (NPM-ALK) and acts as a tumor suppressor by targeting NPM-ALK. PMID: 21715655
  27. IL-2Rgamma(c) reconstituted T cells may persist more efficiently than natural killer (NK) cells due to compensation for suboptimal IL-2Rgamma(c) signaling by T cell receptors. PMID: 20592278
  28. Tumor-shed PGE(2) impairs IL2Rgammac-signaling to inhibit CD4 T cell survival and is regulated by theaflavins PMID: 19812686
  29. Plasma sIL-7Ralpha and sgamma(c) are present as heterocomplexes and sgamma(c) was found to be mainly associated with sIL-7Ralpha PMID: 19494261
  30. presence of membrane-associated as well as soluble gamma c in cell lysates and cell free supernatants from peripheral blood lymphocyte cultures; panel of human serum samples was examined and compared with sIL-2R PMID: 12036606
  31. In normal lung fibroblasts IL-4 & IL-13 induce gamma c chain & its association with JAK3. In myofibroblasts, constitutive gamma c chain together with JAK3 controls TYK2 phosphorylation & the balance between functional & decoy high-affinity receptors. PMID: 12207328
  32. Human IL-21 and IL-4 bind to partially overlapping epitopes of common gamma-chain. PMID: 12504082
  33. The development of breast tumour is associated with an increased expression of IL-2 receptor gamma and this expression also seems to be associated with the malignancy of the tumour. PMID: 14680494
  34. A mutation in this locus resulting in severe combined immunodeficiency, initially diagnosed as HIV infection. PMID: 15702055
  35. The common cytokine receptor gamma-chain is a required signaling subunit of the growth hormone receptor (GHR) complex in B cell lines. Genetic alteration of the IL2RG gene results in growth failure in X-linked severe combined immunodeficiency (X-SCID). PMID: 17082603
  36. results confirm that signal transduction via the IL-15R, and hence NK ontogeny, is preferentially retained relative to the IL-7R as gammac expression becomes limiting. PMID: 17363735
  37. Review describes current state of knowledge of how the gamma c cytokine network is affected during HIV infection, with a focus on how this impairs CD4+ and CD8+ T cell function while also benefiting the virus itself. PMID: 18417356
  38. Report the selective expansion of genetically modified T cells using an antibody/IL2RG receptor chimera. PMID: 18589435
  39. This suggests a role for gamma(C) cytokines in the pathogenesis of diseases in which CD127 expression is altered on CD8+ T cells such as in progressive viral infections and cancer. PMID: 19011158
  40. Self-sufficient growth of B lymphoblastoid cells in X-linked combined immunodeficiency disease (SCID) cell lines is strongly dependent on common gamma-chain expression. PMID: 19234229
  41. the loss of NEDD4 association on IL-2Rgamma(c) is accompanied by a dramatic increase of the half-life of the receptor subunit. PMID: 19615332
  42. Transgenic Jak3-dependent common gamma c cytokine signals are not required for naive primary CD4-positive T cell proliferation and cell cycle regulation in vitro. PMID: 19734221
  43. Meta-analysis and HuGE review of genotype prevalence, gene-disease association, genetic testing, and healthcare-related. (HuGE Navigator) PMID: 14726805
  44. The immature form of the gamma(c) chain is a 54-58 kDa intracellular component localized in the endoplasmic reticulum of resting, unstimulated CD4 T cells. PMID: 11418669

Show More

Hide All

Involvement in disease
Severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell-negative (XSCID); X-linked combined immunodeficiency (XCID)
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell surface.
Protein Families
Type I cytokine receptor family, Type 5 subfamily
Database Links

HGNC: 6010

OMIM: 300400

KEGG: hsa:3561

STRING: 9606.ENSP00000363318

UniGene: Hs.84

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*