Recombinant Human Ephrin-A1 (EFNA1) (Active)

In Stock
Code CSB-MP007460HU
Abbreviation Recombinant Human EFNA1 protein (Active)
MSDS
Size $116
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human EPHA2 (CSB-MP007722HUd7) at 2 μg/mL can bind Human EFNA1. The EC50 is 5.859-7.758 ng/mL.
Target Names
Uniprot No.
Alternative Names
Ephrin-A1; EPH-related receptor tyrosine kinase ligand 1 (LERK-1); Immediate early response protein B61; Tumor necrosis factor alpha-induced protein 4 (TNF alpha-induced protein 4); Ephrin-A1, secreted form; EFNA1; EPLG1, LERK1, TNFAIP4
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-182aa
Target Protein Sequence
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS
Mol. Weight
48.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.
Gene References into Functions
  1. ephrin-A1 seems to be remarkably involved in elementary processes of endothelial migration like cellular polarization, migratory direction and speed. PMID: 27742560
  2. Findings show that EFNA1 expression is a useful marker for predicting a high risk of recurrence in hepatocellular carcinoma patients but not EPHA2. PMID: 24969670
  3. Results suggest that EFNA1 is involved in colorectal tumorigenesis, and rs12904 A>G polymorphism in the 3' UTR of EFNA1 is associated with CRC susceptibility in a Chinese population. PMID: 24175772
  4. EphA2-ephrinA1 trans-endocytosis is sensitive to the mechanical properties of a cell's microenvironment PMID: 24853748
  5. Ephrin-A1 is upregulated in tumor microenvironment and promotes angiogenesis through a coordinated cross-talk with PI3K/Akt-dependent eNOS activation. PMID: 24040255
  6. The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells. PMID: 23686814
  7. Increased expression of EFNA1 mRNA is associated with gastric cancer. PMID: 23065816
  8. Expression of EPHRIN-A1 tends to be associated with worse survival in head and neck cancer. PMID: 24330498
  9. EFNA1 expression is a useful marker for predicting high risk of relapse and cancer-related death in patients who have undergone curative resection for CRC. PMID: 23258614
  10. Findings suggest that the glycosylation on ephrin-A1 plays a critical role in the binding and activation of the EphA2 receptor. PMID: 23661698
  11. present study showed a high expression of EphA2/ephrinA1 in adenoid cystic carcinoma. EphA2/ephrinA1 can serve as a novel therapy target for adenoid cystic carcinoma. PMID: 23298804
  12. EphA2 activation by ephrin-A1 induces tumor suppressor gene cdx-2 expression which attenuates cell proliferation, tumor growth and thus may be a promising therapeutic target against NSCLC. PMID: 22824143
  13. in p-stage I NSCLC patients, those in the higher EphA2 expression and higher ephrin-A1 expression groups shared almost the same clinicopathological backgrounds which are generally considered to be better prognostic factors. PMID: 22236865
  14. The EphA2 ligand EphrinA1 induces EphA2 phosphorylation and intracellular internalization and degradation, thus inhibiting breast tumor progression. PMID: 22228563
  15. Multiple oncogenic signalling pathways are affected by ephrin-A1, from the promotion of a specific pathway in one cell or cancer type to the inhibition of the same pathway in another type of cell or cancer. [Review] PMID: 22040911
  16. Ovarian serous carcinomas and ovarian cancer cell lines overexpress EphA2 and EphrinA-1. Tumor patients with higher expression levels of both EphA2 and EphrinA-1 have a significantly poorer clinical outcome. PMID: 21500549
  17. The Eph-ephrinA system can promote cell attachment along with intercellular dissociation. PMID: 21349856
  18. This study demonstrated that the Eph-ephrin A system can promote intercellular dissociation in Ishikawa cells suggesting an important role in the initial step of embryo implantation by opening the endometrial epithelial cell barrier. PMID: 21138904
  19. Osteosarcoma samples were characterized using genome-wide microarrays: increased expression of the EphA2 receptor and its ligand EFNA1 was detected. PMID: 21166698
  20. up-regulation of EphA2 and down-regulation of Ephrina1 may correlate with poor prognosis for patients with high-grade glioma PMID: 20571968
  21. EphA2 and EphrinA1 are highly expressed in renal cell carcinoma, and positively correlated with histological differentiation, clinical stage and angiogenesis. PMID: 19950554
  22. EFNA1 may be a useful serum marker for the detection of hepatocellular carinoma development and progression. PMID: 19642143
  23. The interaction between EphA2 and this ligand protein is necessary for induction of maximal neovascularization by VEGF. PMID: 12496364
  24. This protein, an EphA ligand, stimulated protein degradation by EphA2. PMID: 12496371
  25. Ephrin-A1 stimulation of Jurkat T cells induces tyrosine phosphorylation of EphA3 receptors and cytoplasmic proteins, including c-cbl proto-oncogene, and causes down-regulation of endogenous EphA3 receptors from the cell surface and their degradation. PMID: 12794130
  26. A new ephrin-A1 isoform, ephrin-A1b, lacks a segment of 22 amino acids (residues 131-152). Exon 3 is spliced out in its transcript. It may regulate the function of its ephrin-A1a counterpart. PMID: 14692877
  27. This study demonstrates for the first time significantly reduced ephrin-A1 expression in T cells of asthma patients. PMID: 14707054
  28. found ephrin-A1 expressed exclusively in the invasive extravillous trophoblast in preeclampsia and normal placenta PMID: 15193868
  29. ephrin-A1 is expressed by venule endothelial cells PMID: 15585656
  30. EPHA2 and EFNA1 expression may influence the behavior of human gastric cancer. PMID: 15649254
  31. low molecular weight protein-tyrosine phosphatase acts as terminator of EphA2 signaling causing efficient negative feedback loop on biological response mediated by ephrinA1; tyrosine phosphorylation main event orchestrating repulsive response PMID: 16051609
  32. High expression of Ephrin A-1 is associated with urinary bladder carcinoma. PMID: 16428472
  33. Activation of ERK-1/2 plays an essential role in ephrin-A1-mediated cell migration, whixh is inhibited by green tea catechin epigallocatechin gallate. PMID: 17049832
  34. Ephrin-A1 serves as a critical negative regulator in the tumorigenesis of gliomas by down-regulating EphA2 and FAK. PMID: 17332925
  35. Increasing ephrin-A expression enhances T-cell interactions not only with purified integrin ligands but also endothelial cells, while EphA activation down-regulates these interactions. PMID: 17980912
  36. Soluble monmomeric EphrinA1 is released from tumor cells and is a functional ligand for the EphA2 receptor. PMID: 18794797
  37. The function of EphA2 and ephrinA1 in tumorigenesis and tumor progression is complex and seems to be dependent on cell type and microenvironment PMID: 19074825
  38. Increased expression of EphA2 and EphrinA-1 plays an important role in the progression human gastric adenocarcinoma. PMID: 19101799
  39. The crystal structures of an A-class complex between EphA2 and ephrin-A1 and of unbound EphA2, are presented. PMID: 19525919

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.; [Ephrin-A1, secreted form]: Secreted.
Protein Families
Ephrin family
Tissue Specificity
Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level).
Database Links

HGNC: 3221

OMIM: 191164

KEGG: hsa:1942

STRING: 9606.ENSP00000357392

UniGene: Hs.516664

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*