Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

In Stock
Code CSB-MP860774HU
Abbreviation Recombinant Human GPR20 protein-VLPs (Active)
MSDS
Size $620
Order now
Image
  • CSB-MP860774HU is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/ml can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC50 is 2.431 - 3.239 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay
  • Greater than 95% as determined by SEC-HPLC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC50 is 2.431 - 3.239 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
Uniprot No.
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-358aa
Target Protein Sequence
MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Mol. Weight
40.0 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.
Description

GPR20 remains an orphan G-protein coupled receptor with poorly defined ligand specificity, making validated full-length constructs essential for deorphanization efforts and functional characterization. This mammalian-expressed construct spans the complete 358-residue sequence and demonstrates specific antibody binding in functional ELISA with an EC50 of 2.431–3.239 ng/mL, confirming that native epitopes are accessible and properly folded. The quantified binding kinetics support use in therapeutic antibody epitope mapping, competitive inhibition screening to identify blocking antibodies, and ligand-binding assays designed to identify endogenous or synthetic agonists. Endotoxin levels below 1.0 EU/μg meet the contamination thresholds commonly required for cell-based functional assays and receptor-ligand interaction studies by surface plasmon resonance or biolayer interferometry, where low background interference is critical for accurate affinity measurements.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Orphan receptor with constitutive G(i) signaling activity that activate cyclic AMP.
Gene References into Functions
  1. GPR20 constitutively activates G(i) proteins without ligand stimulation PMID: 18347022
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Ubiquitous with highest levels in intestinal tissues. In the brain detected in thalamus, putamen, and caudate, but not in frontal cortex, pons and hypothalamus.
Database Links

HGNC: 4475

OMIM: 601908

KEGG: hsa:2843

STRING: 9606.ENSP00000366970

UniGene: Hs.152432

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*