Recombinant Human G-protein coupled receptor 20 (GPR20)-VLPs (Active)

In Stock
Code CSB-MP860774HU
Abbreviation Recombinant Human GPR20 protein-VLPs (Active)
MSDS
Size $630
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody(CSB-RA860774MA1HU). The EC50 is 2.431 - 3.239 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
Uniprot No.
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-358aa
Target Protein Sequence
MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Mol. Weight
40.0 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.
Description

The recombinant human GPR20 protein is presented in the form of virus-like particles (VLPs), allowing for a native-like membrane protein conformation ideal for functional assays. Expressed in mammalian cells to preserve proper folding and post-translational modifications, this recombinant GPR20 protein includes the full-length sequence of human GPR20 (amino acids 1–358) and features a C-terminal 10xHis tag to facilitate purification and detection. It exhibits high purity, greater than 95% as confirmed by SEC-HPLC. Endotoxin levels are controlled below 1.0 EU/μg, validated by the LAL testing. Functional assessment via ELISA demonstrates the GPR20 protein's binding capability. When immobilized at 10 μg/mL, it specifically binds the anti-GPR20 recombinant antibody (CSB-RA860774MA1HU), with an EC50 between 2.431 and 3.239 ng/mL. A VLP (CSB-MP3838) negative control confirms specificity. These characteristics make this GPR20 VLP a robust tool for studying GPCR biology, antibody screening, and drug discovery targeting membrane proteins.

Human GPR20 is a member of the GPCR family, characterized as an orphan receptor due to the absence of identified endogenous ligands. It is encoded by a gene located on chromosome 14 and is of significant interest in physiological and pathological contexts. GPR20 is mainly recognized for its constitutive activity in the absence of a ligand, meaning it can activate intracellular signaling pathways without the need for a specific activating molecule [1]. This distinct feature has implications in various biological processes, including signaling pathways related to neurophysiology and cancer.

Research indicates that GPR20 is expressed in several regions of the human brain, including areas related to motor function and cognition, such as the caudate nuclei and putamen [1]. This widespread expression suggests a potential role in neurophysiological functions and behaviors, as evidenced by studies showing behavioral changes in GPR20-deficient mice [1]. Additionally, the receptor has been implicated in activating inhibitory G-protein signaling, positioning it as a critical player in the modulation of cellular responses [2].

From a pathological perspective, GPR20 has garnered attention in the context of gastrointestinal stromal tumors (GISTs), where it is selectively expressed. Its expression is regulated by key transcription factors related to tumor biology, including FOXF1 and ETV1 [3]. The receptor's exclusive expression in GISTs has led to the development of targeted therapies, such as antibody-drug conjugates specifically designed to recognize GPR20, aiming to improve treatment efficacy for affected patients [3]. Furthermore, its regulation during inflammatory responses has been noted, which can further complicate the understanding of its functional diversity in various tissues.

Beyond its role in cancer, GPR20's association with various signaling pathways, including those related to inflammatory responses, underscores its potential as both a therapeutic target and a biomarker for certain diseases [3]. This receptor has also been associated with neurogenesis and inflammation, indicating its multifaceted roles in human physiology [1].

References:
[1] M. Hase, T. Yokomizo, T. Shimizu, & M. Nakamura. Characterization of an orphan g protein-coupled receptor, gpr20, that constitutively activates gi proteins. Journal of Biological Chemistry, vol. 283, no. 19, p. 12747-12755, 2008. https://doi.org/10.1074/jbc.m709487200
[2] A. Jobe and R. Vijayan. Orphan g protein-coupled receptors: the ongoing search for a home. Frontiers in Pharmacology, vol. 15, 2024. https://doi.org/10.3389/fphar.2024.1349097
[3] K. Iida, A. Ahmed, et al. Identification and therapeutic targeting of gpr20, selectively expressed in gastrointestinal stromal tumors, with ds-6157a, a first-in-class antibody–drug conjugate. Cancer Discovery, vol. 11, no. 6, p. 1508-1523, 2021. https://doi.org/10.1158/2159-8290.cd-20-1434

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Orphan receptor with constitutive G(i) signaling activity that activate cyclic AMP.
Gene References into Functions
  1. GPR20 constitutively activates G(i) proteins without ligand stimulation PMID: 18347022
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Ubiquitous with highest levels in intestinal tissues. In the brain detected in thalamus, putamen, and caudate, but not in frontal cortex, pons and hypothalamus.
Database Links

HGNC: 4475

OMIM: 601908

KEGG: hsa:2843

STRING: 9606.ENSP00000366970

UniGene: Hs.152432

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*