Recombinant Human Hemojuvelin (HJV) (Active)

In Stock
Code CSB-MP765090HU
Abbreviation Recombinant Human HJV protein (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human HJV at 2 μg/ml can bind Anti-HJV recombinant antibody (CSB-RA765090MA1HU). The EC50 is 0.7831-0.8801 ng/mL. Biological Activity Assay
  • Activity
    HJV Recombinant Monoclonal Antibody (CSB-RA765090MA1HU) captured on Protein A Chip can bind Recombinant Human HJV with an affinity constant of 0.973 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human HJV at 2 μg/mL can bind Anti-HJV recombinant antibody (CSB-RA765090MA1HU). The EC50 is 0.7831-0.8801 ng/mL.
②HJV Recombinant Monoclonal Antibody (CSB-RA765090MA1HU) captured on Protein A Chip can bind Recombinant Human HJV with an affinity constant of 0.973 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
Uniprot No.
Alternative Names
Hemojuvelin; Hemochromatosis type 2 protein; Hemojuvelin BMP coreceptor; RGM domain family member C
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
36-400aa
Target Protein Sequence
QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSD
Mol. Weight
40.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Hemojuvelin functions as a BMP co-receptor critical for hepcidin regulation and systemic iron homeostasis, making it a key target in hereditary hemochromatosis and anemia research. This full-length mature protein (aa 36–400) expressed in mammalian cells demonstrates robust conformational integrity, binding an anti-HJV recombinant antibody with a KD of 0.973 nM in MetaSPR assays and achieving an EC50 of 0.78–0.88 ng/mL in functional ELISA. The sub-nanomolar affinity constant supports use in therapeutic antibody epitope mapping, competitive inhibition screening, and ligand-binding interaction studies by SPR or biolayer interferometry. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% align with standards expected in antibody validation workflows and small-molecule inhibitor screening campaigns targeting iron metabolism pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a bone morphogenetic protein (BMP) coreceptor. Through enhancement of BMP signaling regulates hepcidin (HAMP) expression and regulates iron homeostasis.
Gene References into Functions
  1. Urinary HJV differentiated patients with/without acute kidney injury (AKI), advanced AKI or composite outcome after surgery. PMID: 29386545
  2. Soluble haemojuvelin levels seem to be associated with iron overload parameters and hepcidin levels in hepatitis C virus positive hemodialysis patients. PMID: 28130911
  3. HJV increases hepcidin expression in cells transfected with mutant ALK2. Thus, although the BMP pathway is inhibited when normal MT2 cleaves HJV, in the presence of both ALK2wt and mutant ALK2, the heterozygosity for the inactive MT2I212T may leave enough membrane HJV to allow persistent hepcidin activation. PMID: 28476747
  4. A novel homozygous mutation in HJV gene identified in an Arab patient with juvenile hemochromatosis and hepatocellular carcinoma. PMID: 28363629
  5. HJV levels are low in NAFLD and even lower in iron overloaded NAFLD. PMID: 26405701
  6. Data show that transmembrane serine protease TMPRSS6 cleaves both the heterodimeric and the full-length mutant hemojuvelin (m-HJV). PMID: 25704252
  7. Hereditary haemochromatosis caused by homozygous HJV mutation evolved through paternal disomy. PMID: 24635876
  8. The study demonstrates that the two upstream open reading frames (with 28 and 19 codons) present in the 5' UTR of the human HJV mRNA have the ability to significantly decrease translational efficiency under normal conditions. PMID: 25666510
  9. Case Reports: juvenile hemochromatosis associated with simple heterozygosity for novel HJV mutations and unknown genetic factors. PMID: 25152992
  10. suggesting that the homozygous mutation p.C321X in HJV is causative in the patient with hemochromatosis PMID: 25567873
  11. In dialysis patients, hemojuvelin levels are significantly increased but obesity does not have an additional impact. PMID: 24356769
  12. Membrane bound hemojuvelin (HJV) is associated with decreasing total kidney iron, secreting hepcidin, and promoting the degradation of ferroportin during acute kidney injury, whereas soluble HJV does the opposite. PMID: 23901875
  13. Data show that Patients with iron-refractory iron-deficiency anemia with a mutation in the TMPRSS6 gene were found to have lower levels of circulating hemojuvelin than those in healthy patients. PMID: 20713458
  14. The hemochromatosis proteins HFE, TfR2, and HJV form a membrane-associated protein complex for hepcidin regulation. PMID: 22728873
  15. neogenin forms a ternary complex with both MT2 and HJV at the plasma membrane. The complex facilitates HJV cleavage by MT2, and release of the cleaved HJV from the cell occurs after a retrograde trafficking through the TGN/Golgi compartments. PMID: 22893705
  16. sHJV is elevated in hemodialysis patients compared to non-dialysis CKD patients. There was no association between sHJV and eGFR (in the non-dialysis groups), suggesting that factors other than decreased renal clearance are responsible for high sHJV levels PMID: 22398782
  17. Downregulation of hemojuvelin prevents inhibitory effects of bone morphogenetic proteins on iron metabolism in hepatocellular carcinoma. PMID: 21863061
  18. possible involvement of hemojuvelin gene mutation in porphyria cutanea tarda PMID: 21088809
  19. Case Report: Homozygous G320V mutation in the HJV gene causing juvenile hereditary haemochromatosis type A. PMID: 20593054
  20. showed that it localizes to similar subcellular compartments as wild-type TMPRSS6 and binds HJV, but fails to auto-catalytically activate itself. PMID: 20704562
  21. c/hemojuvelin is a broad spectrum bone morphogenetic protein (BMP) antagonist and inhibits both BMP2- and BMP6-mediated signaling and gene expression PMID: 20530805
  22. In this review, HJV plays an essential role in the regulation of hepcidin expression, specifically in the iron-sensing pathway, although through unknown mechanisms. PMID: 19287179
  23. Here we report the positional cloning of the locus associated with juvenile hemochromatosis and the identification of a new gene crucial to iron metabolism. PMID: 14647275
  24. Various amino acid substitutions identified in hemochromatosis. PMID: 14982867
  25. 17 different (16 novel) mutations of HJV, both at the homozygous and at the compound heterozygous state in juvenile hemochromatosis PMID: 14982873
  26. compound heterozygous mutations in hemojuvelin may have a role in juvenile hemochromatosis PMID: 15138164
  27. Hemochromatosis in a consanguineous family linked to a mutation in the recently identified HJV gene. PMID: 15315789
  28. Human HJV mRNA expression was detected in the liver, heart, esophagus, pancreas, descending colon, ileocecum and skeletal muscle. Its role in regulating iron allocation could be extended to other tissues beyond the liver. PMID: 15590393
  29. nonsense mutation (G66X) causes severe juvenile hemochromatosis with fatal cardiomyopathy PMID: 15611318
  30. Juvenile hereditary hemochromatosis is not a distinct monogenic disorder invariably due to hemojuvelin or hepcidin mutations: it may be genetically linked to the adult-onset form of hereditary hemochromatosis. PMID: 15685557
  31. hemojuvelin may have a role in juvenile hemochromatosis [letter, case report] PMID: 15710580
  32. Hemojuvelin-induced increase in intracellular iron levels in human embryonic kidney 293 cells is dependent on the presence of neogenin in the cells, thus linking these two proteins to intracellular iron homeostasis PMID: 16103117
  33. An HFE-independent pathway that seems to involve TFR2 and hemojuvelin can regulate HAMP expression under conditions of iron overload PMID: 16103673
  34. Hjv & transferrin receptor type 2 were predominantly localized to the basolateral membrane domain of hepatocytes; localization of Hjv and TfR2 at the same membrane domain renders a functional interaction of these two proteins in iron homeostasis possible PMID: 16932966
  35. The loss of HJV membrane export is central to the pathogenesis of juvenile hemochromatosis; HJV cleavage is essential for the export. PMID: 17264300
  36. A novel R176C mutation in the juvenile hemochromatosis gene was found in exon 3. This substitution destabilizes a short helix made of the RSF residues (from 176 to 178). PMID: 17339196
  37. Hemojuvelin missense mutation is associated with hemochromatosis. PMID: 17768121
  38. interactive effect on serum ferritin level of rs235756 in BMP2 and a SNP in HJV, with a small additive effect of a SNP in BMP4 PMID: 17847004
  39. s-hemojuvelin release is regulated by a proprotein convertase through the cleavage at a conserved polybasic RNRR site. PMID: 17869549
  40. s-HJV originates from a furin cleavage at position 332-335 PMID: 17938254
  41. results show that different isoforms of hemojuvlin may play unique physiological roles through defined interactions with distinct signaling proteins such as BMP2 and neogenin, and demonstrate that some of these interactions are defective. PMID: 18287331
  42. HJV-mediated bone morphogenetic protein signaling and hepcidin regulation occur via a distinct subset of BMP ligands and BMP receptors, independently of neogenin PMID: 18326817
  43. neogenin is part of a multiprotein complex at the hepatocyte membrane involving bone morphogenetic protein, its receptors, and hemojuvelin PMID: 18335997
  44. neogenin-mediated HJV release occurs after the HJV-neogenin complex is internalized from the cell surface PMID: 18445598
  45. The researchers identified a nonsense Q312X mutation in the hemojuvelin gene that increases ferritin levels and leads to juvenile hemochromatosis that is associated with severe cardiomyopathy. PMID: 18725184
  46. Our results support a model in which retrograde trafficking of HJV before cleavage is the predominant processing pathway PMID: 19029439
  47. The results suggest that the HJV-neogenin interaction is required for the BMP-mediated induction of hepcidin expression when HJV is expressed. PMID: 19564337

Show More

Hide All

Involvement in disease
Hemochromatosis 2A (HFE2A)
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Repulsive guidance molecule (RGM) family
Tissue Specificity
Adult and fetal liver, heart, and skeletal muscle.
Database Links

HGNC: 4887

OMIM: 602390

KEGG: hsa:148738

STRING: 9606.ENSP00000337014

UniGene: Hs.632436

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*