Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/mL can bind Anti-IL12/IL23 recombinant antibody (CSB-RA011587MA1HU), the EC50 is 1.042-1.545 ng/mL.

Target Names

IL12B&IL12A

Uniprot No.

P29460 P29459

Alternative Names

Interleukin-12 subunit alpha;IL-12A;Cytotoxic lymphocyte maturation factor 35 kDa subunit;CLMF p35;IL-12 subunit p35;NK cell stimulatory factor chain 1;NKSF1;IL12A;NKSF1;Interleukin-12 subunit beta;IL-12B;Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;L-12 subunit p40;NK cell stimulatory factor chain 2;NKSF2;IL12B;NKSF2;IL12;

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

23-328aa(IL12B) & 23-219aa(IL12A)

Target Protein Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Mol. Weight

39.7 kDa & 27.2 kDa

Protein Length

Heterodimer

Tag Info

C-terminal 10xHis-tagged & C-terminal Flag-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

IL-12, the heterodimeric cytokine formed by IL-12B (p40) and IL-12A (p35), plays a central role in bridging innate and adaptive immunity by driving Th1 polarization, NK cell activation, and IFN-γ production. This recombinant human IL-12 heterodimer, expressed in mammalian cells and spanning residues 23–328 (IL-12B) and 23–219 (IL-12A) with C-terminal 10×His and Flag tags, preserves the native subunit pairing required for receptor engagement and downstream JAK2/TYK2–STAT4 signaling studies. Functional ELISA confirms binding to an anti-IL-12/IL-23 recombinant antibody with an EC₅₀ of 1.042–1.545 ng/mL, supporting use as a coating antigen for antibody development and validation or as a reference standard in cytokine detection assays. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the stringent criteria needed for PBMC and primary T-cell activation assays, where LPS-driven artifacts could otherwise confound cytokine-attributable responses.

Code	CSB-MP4155HU
Abbreviation	Recombinant Human IL12B&IL12A Heterodimer protein (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel)Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody(CSB-RA011587MA1HU), the EC₅₀ is 1.042-1.545 ng/mL.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human IL12B&IL12A Heterodimer Protein (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage