Recombinant Human IL12B&IL12A Heterodimer Protein (Active)

In Stock
Code CSB-MP4155HU
Abbreviation Recombinant Human IL12B&IL12A Heterodimer protein (Active)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel)Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody(CSB-RA011587MA1HU), the EC50 is 1.042-1.545 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/mL can bind Anti-IL12/IL23 recombinant antibody (CSB-RA011587MA1HU), the EC50 is 1.042-1.545 ng/mL.
Target Names
IL12B&IL12A
Uniprot No.
Alternative Names
Interleukin-12 subunit alpha;IL-12A;Cytotoxic lymphocyte maturation factor 35 kDa subunit;CLMF p35;IL-12 subunit p35;NK cell stimulatory factor chain 1;NKSF1;IL12A;NKSF1;Interleukin-12 subunit beta;IL-12B;Cytotoxic lymphocyte maturation factor 40 kDa subunit;CLMF p40;L-12 subunit p40;NK cell stimulatory factor chain 2;NKSF2;IL12B;NKSF2;IL12;
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-328aa(IL12B) & 23-219aa(IL12A)
Target Protein Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Mol. Weight
39.7 kDa & 27.2 kDa
Protein Length
Heterodimer
Tag Info
C-terminal 10xHis-tagged & C-terminal Flag-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The DNA fragment encoding the human IL12 complex composed of partial human IL12B (Ile23-Ser328) with a C-terminal 10xHis-tag and the mature form of human IL12A ( Arg23-Ser219) with a C-terminal Flag-tag was co-expressed in the mammalian cells. The resultant product is the recombinant human IL12A&IL27B heterodimer protein. It is low in endotoxin, less than 1.0 EU/µg protein determined by the LAL method. The purity of this protein is greater than 95%. This recombinant IL12A&IL27B heterodimer protein has been validated to be biologically active through its interaction with anti-IL12/IL23 recombinant antibody (CSB-RA011587MA1HU). The EC50 for this effect is 1.042-1.545 ng/mL.

IL12, a heterodimer composed of IL12A and IL12B subunits, is a pleiotropic cytokine that targets T cells, NK cells, and bone marrow progenitor cells. IL12 can promote the proliferation of activated T cells and NK cells, enhance the cytotoxicity of T cells and NK cells, and induce the production of IFN-γ and TNF-β. IL12 plays an important role in the anti-tumor and in the balance of Th1/Th2 responses. The critical role of IL12 in anti-tumor immunity is linked to the innate resistance regulated by macrophages and NK cells and the adaptive immunity mediated by Th1 cells and CTL cells. As the research of IL12 antibody drugs becomes hot, the preparation of IL12 protein will promote the development of IL12-related drugs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*