Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human IGHE at 2 μg/mL can bind Anti-IGHE recombinant antibody (CSB-RA16849MA1HU). The EC50 is 3.097-4.487 ng/mL.

Target Names

IGHE

Uniprot No.

P01854

Alternative Names

Immunoglobulin heavy constant epsilon; Ig epsilon chain C region; Ig epsilon chain C region ND; IGHE

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

104-427aa

Target Protein Sequence

VCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG

Mol. Weight

38.4 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

IgE constant region mediates allergic responses and immediate hypersensitivity through high-affinity binding to FcεRI on mast cells and basophils, making it a critical target for therapeutic antibody development and allergy research. This mammalian-expressed fragment spanning residues 104–427 demonstrates quantifiable antibody-binding activity with an EC50 of 3.097–4.487 ng/mL in functional ELISA, providing a validated basis for epitope mapping studies, competitive inhibition assays to screen blocking antibodies, and affinity characterization by surface plasmon resonance or biolayer interferometry. The construct supports drug discovery workflows targeting IgE-mediated pathways, including small-molecule and biologic inhibitor screening against the Fc region. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for ligand-binding assays and therapeutic antibody validation experiments where low background interference is essential.

Target Background

Function

Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen.

Subcellular Location

Secreted. Cell membrane.

Database Links

HGNC: 5522

OMIM: 147180

Code	CSB-MP1684HU3d7
Abbreviation	Recombinant Human IGHE protein, partial (Active)
MSDS	MSDS Datasheet
Size	$156
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human IGHE at 2 μg/ml can bind Anti-IGHE recombinant antibody (CSB-RA16849MA1HU). The EC₅₀ is 3.097-4.487 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Immunoglobulin heavy constant epsilon (IGHE), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage