Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active)

In Stock
Code CSB-MP764932HU
Abbreviation Recombinant Human IGFL1 protein (Active)
MSDS
Size $138
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 μg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.
Target Names
Uniprot No.
Research Area
other
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
25-110aa
Target Protein Sequence
APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Mol. Weight
38.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant human IGFL1 protein is produced by a mammalian expression system. The target protein is expressed with a DNA fragment (Ala25-Ser110) of human IGFL1 fused with a hFc tag at the C-terminus. This active IGFL1 protein has been measured its activity in a functional ELISA. Immobilized human IGFLR1 binds to this IGFL1 protein with EC50 of 32.33-47.52 ng/mL. The SDS-PAGE showed that the purity of this IGFL1 protein was greater than 95%. The IGFL1 protein has an apparent molecular weight of approximately 40 kDa due to glycosylation. The LAL method showed that the protein contained endotoxin less than 1.0 EU/ug. This human IGFL1 protein is in stock now.

IGFL1 is expressed in cancer cell lines, fetal skin, head and neck tumors, normal breast, squamous cell carcinoma, and uterine tumors. IGFL1 expression is up-regulated in human psoriasis skin. Studies showed that human IGFL1 produced may regulate T cell response. Xiaorong Ji et al. found that high IGFL1 expression can be used as an independent prognostic factor of serous ovarian carcinoma.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
4.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: I used IGFL1 (CSB-MP764932HU) and another product Human IGFLR1 (CSB-MP862025HU) I purchased for functional ELISA experiments, which showed good binding activity, and the EC50 was 4.640-5.722 ng/mL. There is no significant difference between different batches, and the repeatability is good!

By Anonymous

Target Background

Function
Probable ligand of the IGFLR1 cell membrane receptor.
Gene References into Functions
  1. Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1. PMID: 21454693
  2. The -1245 A-allele of the IGF1 promoter single nucleotide polymorphism is associated with a small head size and less brain sparing in small for gestational age born subjects PMID: 19147602
Subcellular Location
Secreted.
Protein Families
IGFL family
Tissue Specificity
Detected in ovary and spinal cord.
Database Links

HGNC: 24093

OMIM: 610544

KEGG: hsa:374918

UniGene: Hs.546554

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*