Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 μg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
25-110aa
Target Protein Sequence
APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant human IGFL1 protein is produced by a mammalian expression system. The target protein is expressed with a DNA fragment (Ala25-Ser110) of human IGFL1 fused with a hFc tag at the C-terminus. This active IGFL1 protein has been measured its activity in a functional ELISA. Immobilized human IGFLR1 binds to this IGFL1 protein with EC50 of 32.33-47.52 ng/mL. The SDS-PAGE showed that the purity of this IGFL1 protein was greater than 95%. The IGFL1 protein has an apparent molecular weight of approximately 40 kDa due to glycosylation. The LAL method showed that the protein contained endotoxin less than 1.0 EU/ug. This human IGFL1 protein is in stock now.
IGFL1 is expressed in cancer cell lines, fetal skin, head and neck tumors, normal breast, squamous cell carcinoma, and uterine tumors. IGFL1 expression is up-regulated in human psoriasis skin. Studies showed that human IGFL1 produced may regulate T cell response. Xiaorong Ji et al. found that high IGFL1 expression can be used as an independent prognostic factor of serous ovarian carcinoma.