Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)

In Stock
Code CSB-MP764932HU
Size $518
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 μg/ml can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

Recombinant human IGFL1 protein is produced by a mammalian expression system. The target protein is expressed with a DNA fragment (Ala25-Ser110) of human IGFL1 fused with a hFc tag at the C-terminus. This active IGFL1 protein has been measured its activity in a functional ELISA. Immobilized human IGFLR1 binds to this IGFL1 protein with EC50 of 32.33-47.52 ng/mL. The SDS-PAGE showed that the purity of this IGFL1 protein was greater than 95%. The IGFL1 protein has an apparent molecular weight of approximately 40 kDa due to glycosylation. The LAL method showed that the protein contained endotoxin less than 1.0 EU/ug. This human IGFL1 protein is in stock now.

IGFL1 is expressed in cancer cell lines, fetal skin, head and neck tumors, normal breast, squamous cell carcinoma, and uterine tumors. IGFL1 expression is up-regulated in human psoriasis skin. Studies showed that human IGFL1 produced may regulate T cell response. Xiaorong Ji et al. found that high IGFL1 expression can be used as an independent prognostic factor of serous ovarian carcinoma.

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 μg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.
Target Names IGFL1
Uniprot No. Q6UW32
Research Area other
Molecular Characterization
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 25-110aa
Target Protein Sequence APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Mol. Weight 38.7 kDa
Protein Length Full Length of Mature Protein
Tag Info C-terminal hFc-tagged
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Probable ligand of the IGFLR1 cell membrane receptor.
Gene References into Functions
  1. Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1. PMID: 21454693
  2. The -1245 A-allele of the IGF1 promoter single nucleotide polymorphism is associated with a small head size and less brain sparing in small for gestational age born subjects PMID: 19147602
Subcellular Location Secreted
Protein Families IGFL family
Tissue Specificity Detected in ovary and spinal cord.
Database Links

HGNC: 24093

OMIM: 610544

KEGG: hsa:374918

UniGene: Hs.546554

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1