Recombinant Human Insulin growth factor-like family member 1(IGFL1)

Code CSB-EP764932HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q6UW32
Abbreviation IGFL1
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Research Area Others
Source E.coli
Gene Names IGFL1
Protein Names Recommended name: Insulin growth factor-like family member 1
Expression Region 25-110aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 16.8 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable ligand of the IGFLR1 cell membrane receptor.
Subcellular Location Secreted
Protein Families IGFL family
Tissue Specificity Detected in ovary and spinal cord.
Database Links

HGNC: 24093

OMIM: 610544

KEGG: hsa:374918

UniGene: Hs.546554

Related Products

IGFL1 Antibodies

IGFL1 Antibodies for Homo sapiens (Human)

IGFL1 Proteins

IGFL1 Proteins for Homo sapiens (Human)

IGFL1 ELISA Kit

IGFL1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.