Home
Active Protein
Other
Recombinant Human Lymphocyte antigen 6K (LY6K) (Active)

Recombinant Human Lymphocyte antigen 6K (LY6K) (Active)

^{In Stock}

Code	CSB-MP621061HUd9
Abbreviation	Recombinant Human LY6K protein (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human LY6K at 2 μg/ml can bind Anti-LY6K recombinant antibody (CSB-RA621061MA1HU). The EC₅₀ is 3.695-4.547 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6K at 2 μg/mL can bind Anti-LY6K recombinant antibody (CSB-RA621061MA1HU). The EC50 is 3.695-4.547 ng/mL.

Target Names

LY6K

Uniprot No.

Q17RY6

Alternative Names

Lymphocyte antigen 6K; Ly-6K

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

18-138aa

Target Protein Sequence

DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG

Mol. Weight

43.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

LY6K is a GPI-anchored cell surface protein overexpressed in multiple cancer types, making it a compelling target for therapeutic antibody development and diagnostic biomarker studies. This recombinant protein, spanning residues 18–138 and representing the full-length mature form, demonstrates robust antibody-binding activity with an EC50 of 3.695–4.547 ng/mL in functional ELISA, providing quantitative evidence that supports its use in antibody screening, epitope mapping, and immunoassay development. Mammalian expression ensures native glycosylation and disulfide bond formation critical for maintaining the authentic three-dimensional structure of this GPI-anchored target. The protein meets the quality thresholds commonly required for antibody validation workflows and functional binding studies, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida. May play a role in cell growth.

Gene References into Functions

breast cancer risk and metastasis were significantly associated with not only LY6K expression, but also methylation of CGI shore which induced by SNP242 mutation. PMID: 27494879
miR-192-5p, induced by LY6K, downregulates ERalpha directly and induced tamoxifen resistance in ERalpha-positive breast cancer cells; re-expression of ERalpha in ERalpha-negative breast cancer cells increased miR-500a-3p expression and directly inhibits LY6K expression PMID: 27304060
LY6K overexpression is associated with Breast Cancer Progression, Immune Escape, and Drug Resistance. PMID: 27197181
Data show that TTK protein kinase, lymphocyte antigen 6 complex locus K and insulin-like growth factor (IGF)-II mRNA binding protein 3 are tumor-associated antigens recognized by cytotoxic T lymphocytes and HLA-A24-restricted epitope peptides. PMID: 17784873
AP-1 activation has an important role in promoting LY6K gene expression that regulates cell mobility of breast cancer cells PMID: 22988241
it appears that LY6K is constitutively overexpressed either by copy number changes, or by yet unknown mechanisms in gingivobuccal squamous cell carcinoma PMID: 22072328
Useful as a tumor biomarker and probably as a target for the development of new molecular therapies for cancer treatment. PMID: 18089789