Recombinant Human Lymphocyte antigen 6K (LY6K)

Code CSB-MP621061HUh8
Abbreviation Recombinant Human LY6K protein
MSDS
Size
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
LY6K
Uniprot No.
Research Area
Immunology
Alternative Names
Ly-6K;LY6K;CO16
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
18-138aa
Target Protein Sequence
DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal mFc2a-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida. May play a role in cell growth.
Gene References into Functions
  1. breast cancer risk and metastasis were significantly associated with not only LY6K expression, but also methylation of CGI shore which induced by SNP242 mutation. PMID: 27494879
  2. miR-192-5p, induced by LY6K, downregulates ERalpha directly and induced tamoxifen resistance in ERalpha-positive breast cancer cells; re-expression of ERalpha in ERalpha-negative breast cancer cells increased miR-500a-3p expression and directly inhibits LY6K expression PMID: 27304060
  3. LY6K overexpression is associated with Breast Cancer Progression, Immune Escape, and Drug Resistance. PMID: 27197181
  4. Data show that TTK protein kinase, lymphocyte antigen 6 complex locus K and insulin-like growth factor (IGF)-II mRNA binding protein 3 are tumor-associated antigens recognized by cytotoxic T lymphocytes and HLA-A24-restricted epitope peptides. PMID: 17784873
  5. AP-1 activation has an important role in promoting LY6K gene expression that regulates cell mobility of breast cancer cells PMID: 22988241
  6. it appears that LY6K is constitutively overexpressed either by copy number changes, or by yet unknown mechanisms in gingivobuccal squamous cell carcinoma PMID: 22072328
  7. Useful as a tumor biomarker and probably as a target for the development of new molecular therapies for cancer treatment. PMID: 18089789

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Cell membrane; Lipid-anchor, GPI-anchor. Cytoplasmic vesicle, secretory vesicle, acrosome. Membrane raft.
Tissue Specificity
Specifically expressed in testis (at protein level).
Database Links

HGNC: 24225

OMIM: 615093

KEGG: hsa:54742

STRING: 9606.ENSP00000453042

UniGene: Hs.69517

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*