Recombinant Human R-spondin-1 (RSPO1), partial (Active)

In Stock
Code CSB-MP644834HU1
Abbreviation Recombinant Human RSPO1 protein, partial (Active)
MSDS
Size $156
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/ml can bind Human LGR5(CSB-MP012906HU1), the EC50 is 124.0-174.1 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5(CSB-MP012906HU1), the EC50 is 124.0-174.1 ng/mL.
Target Names
Uniprot No.
Alternative Names
(Roof plate-specific spondin-1) (hRspo1)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-263aa
Target Protein Sequence
RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Mol. Weight
30.2 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human RSPO1 protein is expressed in mammalian cells. Its expression region corresponds to the 31-263aa of the human RSPO1. It is fused with a 10xHis-Avi-tag at the C-terminus. The resulting recombinant RSPO1 protein is extracted after cell lysis and purified with affinity chromatography. SDS-PAGE confirms its purity above 95%, and the LAL method ensures its endotoxin levels are below 1.0 EU/μg. It is validated to be an active protein. Functional ELISA validates its binding to the human LGR5 (CSB-MP012906HU1), with an EC50 of 124.0-174.1 ng/mL.

Human RSPO1 is a member of the R-spondin family of secreted proteins, which play critical roles in enhancing Wnt signaling pathways, particularly the Wnt/β-catenin pathway. RSPO1 is known for its ability to stabilize β-catenin, a key effector in Wnt signaling, thereby promoting various biological processes including cell proliferation, differentiation, and tissue homeostasis [1][2]. RSPO1 is characterized by two furin-like repeats and a thrombospondin type 1 repeat, which are essential for its signaling activity [3][4].

RSPO1 is expressed in various tissues, including the intestine and gonads, and has been implicated in developmental processes such as ovarian development and nephron progenitor maintenance [5][6][7]. Its expression is particularly significant during early ovarian development, where it augments β-catenin signaling, suggesting a role in sexual differentiation [5][7]. Furthermore, mutations in the RSPO1 gene have been associated with disorders of sex development, including cases of male-to-female sex reversal [8][9].

RSPO1 has been shown to influence keratinocyte proliferation and differentiation, making it relevant in the context of skin cancers such as squamous cell carcinoma [10][11]. Moreover, RSPO1's interaction with other proteins, such as LGR4 and LGR5, facilitates its signaling capabilities, linking it to various cellular responses and potentially to tumorigenesis [11][12].

Recent studies have also explored the role of RSPO1 in metabolic processes, particularly its association with obesity and insulin resistance [13][14]. Additionally, RSPO1 has been identified as a protective factor against radiation-induced gastrointestinal damage, further emphasizing its significance in tissue repair and regeneration [15][16].

References:
[1] M. Tsuchiya, Y. Niwa, & S. Simizu. N-glycosylation of r-spondin1 at asn137 negatively regulates its secretion and wnt/β-catenin signaling-enhancing activity, Oncology Letters, vol. 11, no. 5, p. 3279-3286, 2016. https://doi.org/10.3892/ol.2016.4425
[2] O. Elkady. R-spondin-1 level in different dermatoses: a comprehensive review, Benha Journal of Applied Sciences, vol. 8, no. 2, p. 25-29, 2023. https://doi.org/10.21608/bjas.2023.216091.1186
[3] S. Tomaselli, F. Megiorni, C. Bernardo, A. Felici, G. Marrocco, G. Maggiulli, et al. Syndromic true hermaphroditism due to an r-spondin1 (rspo1) homozygous mutation, Human Mutation, vol. 29, no. 2, p. 220-226, 2008. https://doi.org/10.1002/humu.20665
[4] Y. Xie, R. Zamponi, O. Charlat, M. Ramones, S. Swalley, X. Jiang, et al. Interaction with both znrf3 and lgr4 is required for the signalling activity of r‐spondin, Embo Reports, vol. 14, no. 12, p. 1120-1126, 2013. https://doi.org/10.1038/embor.2013.167
[5] S. Tomaselli, F. Megiorni, L. Lin, M. Mazzilli, D. Gerrelli, S. Majore, et al. Human rspo1/r-spondin1 is expressed during early ovary development and augments β-catenin signaling, Plos One, vol. 6, no. 1, p. e16366, 2011. https://doi.org/10.1371/journal.pone.0016366
[6] V. Vidal, F. Motamedi, S. Rekima, E. Gregoire, E. Szenker‐Ravi, M. Leushacke, et al. R-spondin signalling is essential for the maintenance and differentiation of mouse nephron progenitors, Elife, vol. 9, 2020. https://doi.org/10.7554/elife.53895
[7] C. Smith, C. Shoemaker, K. Roeszler, J. Queen, D. Crews, & A. Sinclair. Cloning and expression of r-spondin1in different vertebrates suggests a conserved role in ovarian development, BMC Developmental Biology, vol. 8, no. 1, 2008. https://doi.org/10.1186/1471-213x-8-72
[8] M. Volleth and P. Wieacker. WNT4 and RSPO1 are not involved in a case of male-to-female sex reversal with partial duplication of 1p, Sexual Development, vol. 1, no. 2, p. 111-113, 2007. https://doi.org/10.1159/000100032
[9] K. Tallapaka, V. Venugopal, A. Dalal, & S. Aggarwal. Novel rspo1 mutation causing 46,xx testicular disorder of sex development with palmoplantar keratoderma: a review of literature and expansion of clinical phenotype, American Journal of Medical Genetics Part A, vol. 176, no. 4, p. 1006-1010, 2018. https://doi.org/10.1002/ajmg.a.38646
[10] E. Choi, J. Yun, E. Jeon, H. Won, Y. Ko, & S. Kim. Prognostic significance of rspo1, wnt1, p16, wt1, and sdc1 expressions in invasive ductal carcinoma of the breast, World Journal of Surgical Oncology, vol. 11, no. 1, 2013. https://doi.org/10.1186/1477-7819-11-314
[11] A. Glinka, C. Dolde, N. Kirsch, Y. Huang, O. Kazanskaya, D. Ingelfinger, et al. Lgr4 and lgr5 are r‐spondin receptors mediating wnt/β‐catenin and wnt/pcp signalling, Embo Reports, vol. 12, no. 10, p. 1055-1061, 2011. https://doi.org/10.1038/embor.2011.175
[12] X. Gong, K. Carmon, Q. Lin, A. Thomas, J. Yi, & Q. Liu. Lgr6 is a high affinity receptor of r-spondins and potentially functions as a tumor suppressor, Plos One, vol. 7, no. 5, p. e37137, 2012. https://doi.org/10.1371/journal.pone.0037137
[13] Y. Kang, J. Kim, H. Yi, K. Joung, H. Kim, & B. Ku. Serum r-spondin 1 is a new surrogate marker for obesity and insulin resistance, Diabetes & Metabolism Journal, vol. 43, no. 3, p. 368, 2019. https://doi.org/10.4093/dmj.2018.0066
[14] O. BAŞPINAR>, Y. Simsek, D. Kocer, O. Dizdar, & H. Does Serum R-Spondin-1 Play a Role in PCOS Pathophysiology? Genel Tıp Dergisi, vol. 32, no. 5, p. 490-493, 2022. https://doi.org/10.54005/geneltip.1111079
[15] P. Bhanja, S. Saha, R. Kabarriti, L. Liu, N. Roy‐Chowdhury, J. Roy‐Chowdhury, et al. Protective role of r-spondin1, an intestinal stem cell growth factor, against radiation-induced gastrointestinal syndrome in mice, Plos One, vol. 4, no. 11, p. e8014, 2009. https://doi.org/10.1371/journal.pone.0008014
[16] J. Zhao, K. Kim, J. Vera, S. Palencia, M. Wagle, & A. Abo. R-spondin1 protects mice from chemotherapy or radiation-induced oral mucositis through the canonical wnt/β-catenin pathway, Proceedings of the National Academy of Sciences, vol. 106, no. 7, p. 2331-2336, 2009. https://doi.org/10.1073/pnas.0805159106

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1.
Gene References into Functions
  1. first report of a RSPO1 missense mutation in association with human disease (familial 46,XX disorder of sexual development) . PMID: 29262419
  2. Rspo1 increases the number of Lgr5(+) liver stem cells in human liver fibrosis tissues, and once they are isolated, these cells are able to form organoids, and treatment with HGF/Rspo1 promotes their expansion PMID: 29079780
  3. RSPOs facilitate HSC activation and promote liver fibrogenesis by enhancing the Wnt pathway PMID: 27572318
  4. Role of RSPO1 in gastric cancer PMID: 28219935
  5. Results showed that Rspo1 expression is downregulated in adult follicles but its activation is sufficient in promoting ovarian tumors supporting its direct involvement in the initiation of ovarian cancers. PMID: 27270435
  6. We highlight the cooperation of WNT4, RSPO1 and FOXL2 within a regulatory network and the need for further research to better understand their role in defining and maintaining ovarian identity. PMID: 27604691
  7. Rspo1 glycosylation at Asn137 is essential for secretion and stability but not for heparin binding. PMID: 27314333
  8. DPY19L3-mediated C-mannosylation of Rspo1 at tryptophan(156) is required for Rspo1 secretion. PMID: 26764097
  9. Genetic variants in ZC3H11B, RSPO1, and GJD2 are associated with susceptibility to the development of high myopia in a Han Chinese population. PMID: 26485405
  10. R-Spondin1 has an effect on radiosensitivity of glioma cells PMID: 25865226
  11. ZNRF3 and LGR4-binding sites in RSPO1 are required for Wnt signaling. PMID: 24165923
  12. Changes in the expression levels of IRS1, IRS2, RIPK2, RSPO1, and DNA JC15 genes might contribute to the development of insulin resistance and glucose intolerance in the obese boys. PMID: 26040030
  13. the LGR4-Rspo1 complex crystal structure shows divergent mechanisms of ligand recognition by leucine-rich repeat G-protein-coupled receptors PMID: 25480784
  14. ZNRF3 binds RSPO1 and LGR5-RSPO1 with micromolar affinity via RSPO1 furin-like 1 (Fu1) domain. PMID: 24349440
  15. overexpressed in fibrotic liver tissue PMID: 25218283
  16. Loss of RSPO1 expression is associated with invasive ductal carcinoma of the breast. PMID: 24373193
  17. RSPO-LGR4 not only induces the clearance of RNF43/ZNRF3 to increase Wnt receptor levels but also recruits IQGAP1 into the Wnt signaling complex. PMID: 24639526
  18. Crystal structures of the Lgr4 ectodomain alone and bound to Rspo1. PMID: 23891289
  19. In conclusion, present study highlights the role of Rspo 1 in bone remodeling where it activates Wnt signaling to induce differentiation, as shown in human as well murine in vitro osteoblast cell models. PMID: 23617070
  20. Recent developments have demonstrated that ovarian development is an active process (rather than a default process); ovarian development/function requires expression of RSPO1, WNT4, and FOXL2. [REVIEW] PMID: 23044875
  21. R-Spondin potentiates Wnt/beta-catenin signaling through orphan receptors LGR4 and LGR5 PMID: 22815884
  22. study provides new mechanistic insights into the regulation of Wnt receptor turnover, and reveals ZNRF3 as a tractable target for therapeutic exploration PMID: 22575959
  23. R-spondin1 is upregulated during critical stages of early human ovary development and may function as a tissue-specific amplifier of beta-catenin signaling to oppose testis determination. PMID: 21297984
  24. identified a gene, R-spondin1, with potent and specific proliferative effects on intestinal crypt cells PMID: 16109882
  25. Human R-spondin1 (RSPO1) is the gene disrupted in a recessive syndrome characterized by XX sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin. PMID: 17041600
  26. RSPO1 regulates Wnt signaling by inhibiting internalization of LRP6. PMID: 17804805
  27. Mutational analysis of the RSPO1 gene in a 46,XX woman with true hermaphroditism, palmoplantar keratoderma, congenital bilateral corneal opacities, onychodystrophy, and hearing impairment, is reported. PMID: 18085567
  28. R-sponin1 (Rspo1) acted synergistically with Wnt3A to activate Wnt/beta-catenin signaling in the uncommitted mesenchymal C2C12 cells. PMID: 18242177
  29. SRY represses the transcriptional of the Rspo1/Wnt target genes involved in ovarian determination. PMID: 19376480
  30. Mice treated with R-spondin1 showed increased intestinal epithelial healing, providing a protective effect against chemotherapy-induced intestinal mucositis. PMID: 16306530

Show More

Hide All

Involvement in disease
Keratoderma, palmoplantar, with squamous cell carcinoma of skin and sex reversal (PKKSCC)
Subcellular Location
Secreted. Nucleus.
Protein Families
R-spondin family
Tissue Specificity
Abundantly expressed in adrenal glands, ovary, testis, thyroid and trachea but not in bone marrow, spinal cord, stomach, leukocytes colon, small intestine, prostate, thymus and spleen.
Database Links

HGNC: 21679

OMIM: 609595

KEGG: hsa:284654

STRING: 9606.ENSP00000348944

UniGene: Hs.135015

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*