Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5(CSB-MP012906HU1), the EC50 is 124.0-174.1 ng/mL.
Alternative Names
(Roof plate-specific spondin-1) (hRspo1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
31-263aa
Target Protein Sequence
RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Tag Info
C-terminal 10xHis-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human R-spondin-1 (RSPO1) protein was produced in the mammalian cells with the plasmid vector containing a synthesized gene. The synthesized gene was formed by fusing the 10xHis-Avi-tag gene to the C-terminus of the gene encoding the 31-263aa of the human RSPO1. This recombinant RSPO1 protein has been validated to be biologically active. In the functional ELISA, this human RSPO1 can bind to the human LGR5, with the EC50 of 124.0-174.1 ng/mL. Its purity is greater than 95% estimated by SDS-PAGE, and its endotoxin level is less than 1.0 EU/ug assessed by the LAL method.
In bipotent gonads during embryonic development, RSPO1 functions as an early ovarian determinant to activate the WNT/β-catenin signaling pathway, with WNT4 being the key ligand, thus allowing ovarian differentiation. In male gonads, Sry binds to the β-catenin/TCF transcription complex and inhibits the activation of WNT signaling by RSPO1, allowing testis differentiation. RSPO1 also can promote osteoblastic differentiation and bone formation, protect against inflammatory bone damage, and reduce age-induced bone loss. RSPO1 is involved in the pathogenesis of De la Chapelle syndrome, true hermaphroditism (TH), and intestinal ischemia-reperfusion injury (IRI). Understanding how RSPO1 participates in sexual differentiation will lead to greater breakthroughs and provide more help for clinical diagnosis and treatment.