Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)

In Stock
Code CSB-MP023989HU
Abbreviation Recombinant Human TNFSF13 protein (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/ml can bind Human TNFRSF17 protein (CSB-MP023974HU1-B). The EC50 is 0.8083-0.9391 ng/mL. Biological Activity Assay
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/ml can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/mL can bind Human TNFRSF17 protein (CSB-MP023974HU1-B). The EC50 is 0.8083-0.9391 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL.
Target Names
Uniprot No.
Alternative Names
Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand (APRIL); TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2); TNF-related death ligand 1 (TRDL-1); CD256; TNFSF13; APRIL, TALL2, ZTNF2; UNQ383/PRO715
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
105-250aa
Target Protein Sequence
AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Mol. Weight
42.6 kDa
Protein Length
Full Length of Mature Protein of Isoform Alpha
Tag Info
N-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

APRIL (TNFSF13) plays a central role in B cell survival and plasma cell differentiation by engaging BCMA (TNFRSF17) and TACI (TNFRSF13B), making it a key target in autoimmune disease and multiple myeloma research. This mammalian-expressed protein, spanning the full-length mature sequence (aa 105–250 of isoform alpha), demonstrates robust receptor binding with an EC50 of 0.8083–0.9391 ng/mL for human BCMA and 11.13–18.97 ng/mL for cynomolgus TACI, providing quantitative benchmarks for cell-based functional assays including B cell proliferation, plasma cell differentiation, and NF-κB signaling pathway activation studies. The low-nanogram potency supports dose-response experiments in primary human PBMCs and B cell lines, while cross-reactivity with cynomolgus TACI enables translational studies in non-human primate models of systemic lupus erythematosus or antibody-mediated rejection. Endotoxin levels below 1.0 EU/μg and purity exceeding 90% meet the quality thresholds commonly required for immune cell assays where LPS contamination would confound cytokine-specific responses.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*