Home
Active Protein
Other
Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)

Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)

^{In Stock}

Code	CSB-MP023989HU
Abbreviation	Recombinant Human TNFSF13 protein (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/ml can bind Human TNFRSF17 protein (CSB-MP023974HU1-B). The EC₅₀ is 0.8083-0.9391 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/ml can bind Human TNFSF13 protein. The EC₅₀ is 11.13-18.97 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/mL can bind Human TNFRSF17 protein (CSB-MP023974HU1-B). The EC50 is 0.8083-0.9391 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL.

Target Names

TNFSF13

Uniprot No.

O75888-1

Alternative Names

Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand (APRIL); TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2); TNF-related death ligand 1 (TRDL-1); CD256; TNFSF13; APRIL, TALL2, ZTNF2; UNQ383/PRO715

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

105-250aa

Target Protein Sequence

AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Mol. Weight

42.6 kDa

Protein Length

Full Length of Mature Protein of Isoform Alpha

Tag Info

N-terminal hFc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.