Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC50 is 0.2699-0.5613 ng/ml.
Alternative Names
(B-cell-activating factor receptor)(BAFF receptor)(BAFF-R)(BLyS receptor 3)(CD268)(BAFFR)(BR3)
Molecular Characterization
Species
Homo sapiens (Human)
Target Protein Sequence
SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Tag Info
C-terminal hFc-Flag-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant human TNFRSF13C carrying a C-terminal hFc-Flag-tag is a partial-length protein expressed in mammalian cells. The DNA fragment used to prepare this recombinant protein corresponds to amino acid residues Ser7-Ala71 of human TNFRSF13C protein. Its purity is greater than 95% determined by SDS-PAGE. A molecular mass band of approximately 40 kDa was visualized on the gel. The endotoxin of this recombinant TNFRSF13C protein is less than 1.0 EU/ug measured by the LAL method. It has been validated as an active protein. In the function ELISA, this TNFRSF13C protein can bind to TNFSF13B or Biotinylated human TNFSF13B, with the EC50 of 9.943-15.72 ng/ml and 0.2699-0.5613 ng/ml, respectively. And it is available now.
TNFRSF13C, also called BAFFR, is one of the main pro-survival receptors in B cells. BAFFR ligation with its ligand BAFF regulates protein synthesis and energy metabolism necessary for the extension of the half-life of immature, transitional, and mature B cells, as well as other basic survival functions.
