Recombinant Human Tumor necrosis factor receptor superfamily member 17(TNFRSF17),partial (Active)

In Stock
Code CSB-MP023974HU1
Product Type Other
Size US$368
Uniprot No. Q02223
Relevance Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.
Protocols Biological Activity Assay
Molecular Characterization
  • Linker (DAAQPARRAVRRT)

  • Human TNFRSF17(Met 1-Ala 54)Q02223

  • Linker(GRGSENLYFQGGGGGS)

  • Human IgG1 FC(Pro 100-Lys 330)P01857

Storage Buffer Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Alias B-cell maturation protein (CD_antigen: CD269) (BCM) (BCMA)
Species Homo sapiens (Human)
Biological_Activity Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Sequence MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Research Area Cancer
Source Mammalian cell
Gene Names Tnfrsf17
Expression Region 1-54aa
Tag Info C-terminal FC-tagged
Mol. Weight 34.8 kDa
Protein Description Partial
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
Involvement in disease A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.
Subcellular Location Cell membrane, Single-pass type III membrane protein, Endomembrane system, Single-pass type III membrane protein
Tissue Specificity Expressed in mature B-cells, but not in T-cells or monocytes.
Database Links

HGNC: 11913

OMIM: 109545

KEGG: hsa:608

STRING: 9606.ENSP00000053243

UniGene: Hs.2556

Pathway Target Therapy

Related Products

Tnfrsf17 Antibodies

Tnfrsf17 Antibodies for Homo sapiens (Human)

Tnfrsf17 Proteins

Tnfrsf17 Proteins for Homo sapiens (Human)

Tnfrsf17 ELISA Kit

Tnfrsf17 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.