Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 10 μg/ml can bind human BCMA, the EC50 of human BCMA protein is 221.3-298.6 ng/ml. ③Human TNFSF13B protein Fc tag (CSB-MP897523HU1) captured on COOH chip can bind Human BCMA protein Fc tag (CSB-MP023974HU1) with an affinity constant of 39 nM as detected by LSPR Assay.④Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC50 is 0.1752-0.3657 ng/ml.
Alternative Names
B cell maturation antigen; B cell maturation factor; B cell maturation protein; B-cell maturation protein; BCM; BCMA; CD269; CD269 antigen; TNFRSF17; TNR17_HUMAN; Tumor necrosis factor receptor superfamily member 17
Molecular Characterization
Species
Homo sapiens (Human)
Target Protein Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) is a partial-length receptor produced in mammalian cells. A DNA sequence encoding the TNFRSF17 (1-54aa) was fused with an hFc-tag at C-terminal. Recombinant TNFRSF17 finds applications in studies involving cancer cells.
TNFRSF17 is a cell surface receptor usually expressed on B-cells. It is activated by ligands from the TNF 13b superfamily and TRAF family. On activation, it transmits signals that play a part in the activation of NF-kb and JNK/MAPK8 pathways.
In T-cell acute lymphoblastic leukemia and multiple myeloma, chromosomal errors in TNFRSF17 have been linked to aberrant activation of NF-kb and JNK. Aberrant activation of NF-kb and JNK pathways contributes to cancer-cell proliferation, metastasis, angiogenesis, and the inhibition of cancer-cell apoptosis.
The product has a molecular weight of 34.8 kDa, and purity levels over 90%, as verified using discontinuous SDS-PAGE. Its activity is verified with ELISA and LSPR assay.
