Name: Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)
Brand: CUSABIO
SKU: CSB-MP023974HU1
Price: $138 USD
Availability: InStock
Rating: 5.0 (1 reviews)

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 10 μg/ml can bind human BCMA, the EC₅₀ of human BCMA protein is 221.3-298.6 ng/ml. ③Human TNFSF13B protein Fc tag (CSB-MP897523HU1) captured on COOH chip can bind Human BCMA protein Fc tag (CSB-MP023974HU1) with an affinity constant of 39 nM as detected by LSPR Assay.④Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC₅₀ is 0.1752-0.3657 ng/ml.

Target Names

TNFRSF17

Uniprot No.

Q02223

Research Area

Cancer

Alternative Names

B cell maturation antigen; B cell maturation factor; B cell maturation protein; B-cell maturation protein; BCM; BCMA; CD269; CD269 antigen; TNFRSF17; TNR17_HUMAN; Tumor necrosis factor receptor superfamily member 17

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-54aa

Target Protein Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Mol. Weight

34.8 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

BCMA (TNFRSF17/CD269) is a critical therapeutic target in multiple myeloma, and this recombinant construct covers the extracellular ligand-binding domain (residues 1–54) fused to a C-terminal hFc1 tag, providing the minimal receptor architecture necessary for ligand and antibody interaction studies. Functional ELISA validation demonstrates that immobilized BCMA at 2 μg/ml binds anti-BCMA recombinant antibody with an EC50 of 1.912–2.488 ng/ml, confirming conformational integrity suitable for therapeutic antibody epitope mapping, blocking antibody screening, and affinity characterization by SPR or BLI. Mammalian cell expression ensures native-like glycosylation and proper disulfide bond formation within this cysteine-rich domain, which supports use in receptor-ligand interaction assays and as a positive control in binding studies for biologic inhibitor discovery. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays in immuno-oncology research.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : ELISA standard and its raw materials

Review: We coated TNFRSF17 on the plate and performed a functional ELISA experiment with the ligand human TNFSF13B-Biotinylated, and the EC50 was 0.3101-0.5710 ng/ml, showing good binding activity. Since it will be used as standard in my subsequent experiment for activity testing, which requires high protein purity, low endotoxin, and good biological activity, CUSABIO\'s product has just met our needs perfectly, and the subsequent experiments have progressed smoothly!

By Anonymous

Code	CSB-MP023974HU1
Abbreviation	Recombinant Human Tnfrsf17 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC₅₀ of human BCMA protein is 1.912-2.488 ng/ml. Biological Activity Assay Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 10 μg/ml can bind human BCMA, the EC₅₀ of human BCMA protein is 221.3-298.6 ng/ml. Biological Activity Assay Human TNFSF13B protein Fc tag (CSB-MP897523HU1) captured on COOH chip can bind Human BCMA protein Fc tag (CSB-MP023974HU1) with an affinity constant of 39 nM as detected by LSPR Assay. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC₅₀ is 0.1752-0.3657 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage