Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-MP023974HU1 |
| Product Type | Other |
| Size | US$368 |
| Uniprot No. | Q02223 |
| Relevance | Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. |
| Image |
|
| Protocols | Biological Activity Assay |
| Molecular Characterization |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Alias | B-cell maturation protein (CD_antigen: CD269) (BCM) (BCMA) |
| Species | Homo sapiens (Human) |
| Biological_Activity | Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Research Area | Cancer |
| Source | Mammalian cell |
| Gene Names | Tnfrsf17 |
| Expression Region | 1-54aa |
| Tag Info | C-terminal FC-tagged |
| Mol. Weight | 34.8 kDa |
| Protein Description | Partial |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. |
| Involvement in disease | A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2. |
| Subcellular Location | Cell membrane, Single-pass type III membrane protein, Endomembrane system, Single-pass type III membrane protein |
| Tissue Specificity | Expressed in mature B-cells, but not in T-cells or monocytes. |
| Database Links |
HGNC: 11913 OMIM: 109545 KEGG: hsa:608 STRING: 9606.ENSP00000053243 UniGene: Hs.2556 |
| Pathway | Target Therapy |
Tnfrsf17 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA593360 | TNFRSF17 Antibody | Human,Mouse | ELISA,WB |
| CSB-PA057490 | TNFRSF17 Antibody | Human,Mouse | ELISA,WB,IHC |
| CSB-PA220479 | TNFRSF17 Antibody | Human | WB,ELISA |
Tnfrsf17 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-AP002271HU | Recombinant Human Tumor necrosis factor receptor superfamily member 17 protein(TNFRSF17),partial (Active) | E.coli |
Tnfrsf17 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL023974HU | Human Tumor necrosis factor receptor superfamily member 17(TNFRSF17) ELISA kit | Request Information |
Recombinant Human Glutathione S-transferase kappa 1(GSTK1) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cyclic AMP-dependent transcription factor ATF-3(ATF3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Pyruvate kinase isozymes R/L(PKLR)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Tryptophan 2,3-dioxygenase(TDO2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Sulfotransferase family cytosolic 2B member 1(SULT2B1)
Express system: E.coli
Species: Homo sapiens (Human)
