Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)

In Stock
Code CSB-MP023974HU1
Size $228
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.

    Biological Activity Assay
  • Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 10 μg/ml can bind human BCMA, the EC50 of human BCMA protein is 221.3-298.6 ng/ml.

    Biological Activity Assay

  • Human TNFSF13B protein Fc tag (CSB-MP897523HU1) captured on COOH chip can bind Human BCMA protein Fc tag (CSB-MP023974HU1) with an affinity constant of 39 nM as detected by LSPR Assay.

    Biological Activity Assay
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC50 is 0.1752-0.3657 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 10 μg/ml can bind human BCMA, the EC50 of human BCMA protein is 221.3-298.6 ng/ml. ③Human TNFSF13B protein Fc tag (CSB-MP897523HU1) captured on COOH chip can bind Human BCMA protein Fc tag (CSB-MP023974HU1) with an affinity constant of 39 nM as detected by LSPR Assay.④Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC50 is 0.1752-0.3657 ng/ml.
Target Names
TNFRSF17
Uniprot No.
Research Area
Cancer
Alternative Names
B cell maturation antigen; B cell maturation factor; B cell maturation protein; B-cell maturation protein; BCM; BCMA; CD269; CD269 antigen; TNFRSF17; TNR17_HUMAN; Tumor necrosis factor receptor superfamily member 17
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-54aa
Target Protein Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Mol. Weight
34.8 kDa
Protein Length
Partial
Tag Info
C-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) is a partial-length receptor produced in mammalian cells. A DNA sequence encoding the TNFRSF17 (1-54aa) was fused with an Fc-tag at C-terminal. Recombinant TNFRSF17 finds applications in studies involving cancer cells.
TNFRSF17 is a cell surface receptor usually expressed on B-cells. It is activated by ligands from the TNF 13b superfamily and TRAF family. On activation, it transmits signals that play a part in the activation of NF-kb and JNK/MAPK8 pathways.
In T-cell acute lymphoblastic leukemia and multiple myeloma, chromosomal errors in TNFRSF17 have been linked to aberrant activation of NF-kb and JNK. Aberrant activation of NF-kb and JNK pathways contributes to cancer-cell proliferation, metastasis, angiogenesis, and the inhibition of cancer-cell apoptosis.
The product has a molecular weight of 34.8 kDa, and purity levels over 90%, as verified using discontinuous SDS-PAGE. Its activity is verified with ELISA and LSPR assay.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : ELISA standard and its raw materials

Review: We coated TNFRSF17 on the plate and performed a functional ELISA experiment with the ligand human TNFSF13B-Biotinylated, and the EC50 was 0.3101-0.5710 ng/ml, showing good binding activity. Since it will be used as standard in my subsequent experiment for activity testing, which requires high protein purity, low endotoxin, and good biological activity, CUSABIO\'s product has just met our needs perfectly, and the subsequent experiments have progressed smoothly!

By Anonymous

Target Background

Function
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
Gene References into Functions
  1. Expression patterns of BAFF and its receptor BCMA differ according to lupus nephritis class. PMID: 29087261
  2. High BCMA expression is associated with primary central nervous system lymphoma. PMID: 28521029
  3. soluble BCMA sequesters circulating BAFF, thereby preventing it from performing its signaling to stimulate normal B-cell and plasma cell development, resulting in reduced polyclonal antibody levels in multiple myeloma patients. PMID: 26960399
  4. Studied expression of B-cell maturation antigen (BCMA) in osteoblasts and the toxic effect of chromium on its expression; found BCMA is involved in osteogenesis of osteoblasts; chromium downregulates expression of BCMA in osteoblasts. PMID: 26011700
  5. BCMA has other contributors for ligands binding except DxL motif. The affinity of BCMA for APRIL higher than for BAFF may be caused by the segment outside of the conservative DxL motif. Moreover, the exposition of new binding modes of BCMA2 interacting with APRIL may establish the foundation of designing novel drugs in the future PMID: 28260502
  6. New molecular mechanisms of in vivo Multiple Myeloma (MM) growth and immunosuppression critically dependent on BCMA and APRIL in the Bone marrow microenvironment, further supporting targeting this prominent pathway in MM. PMID: 27127303
  7. We have identified a specific serum protein, BCMA, as a novel independent marker for both monitoring and predicting outcomes for MM patients. We have shown that sBCMA is elevated in MM patients, and can be used to follow their disease status, PFS and OS. PMID: 28034989
  8. The expression levels of serum BAFF and the three receptors (TACI, BCMA and BAFF-R) in non-Hodgkin lymphoma patients were significantly higher than in healthy controls. PMID: 28028945
  9. Decreased BCMA expression on peripheral B cells according to severe disease activity suggests that BCMA plays an important regulating role in B-cell hyperactivity and immune tolerance homeostasis in systemic lupus erythematosus patients PMID: 26424128
  10. results suggest that Akt and JNK pathways are involved in the regulation of B-cell maturation antigen (BCMA) PMID: 26914861
  11. shedding of BCMA by gamma-secretase controls plasma cells in the bone marrow and yields a potential biomarker for B-cell involvement in human autoimmune diseases PMID: 26065893
  12. elevated serum levels in patients with Behcet's disease PMID: 25759827
  13. Data show significant differences in expression of tumour necrosis factor family (BAFF) receptors BAFF-R, BCMA and TACI in patients with and without anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies. PMID: 25301447
  14. High BCMA expression is associated with breast cancer. PMID: 25750171
  15. BAFF and APRIL as well as their cognate receptors (BCMA, TACI) correlate with glioma grade. (Meta-analysis) PMID: 24376672
  16. The B cell maturation antigen (BCMA) is a tumor necrosis family receptor member that is predominantly expressed on terminally differentiated B cells and, upon binding to its ligands B cell activator of the TNF family and a proliferation inducing ligand. PMID: 23237506
  17. Activation of B cells through BCMA regulates spinal cord injury-induced autoimmunity via a proliferation-inducing ligand (APRIL) and B-cell-activating factor (BAFF). PMID: 23088438
  18. Data indicate that MAGE3, Survivin and B-cell maturation antigen (BCMA) mRNA-pulsed dendritic cells (DCs) are capable of stimulating tumor-associated antigens (TAA)-specific T-cell responses in multiple myeloma (MM) patients. PMID: 23728352
  19. Data indicate that B-cell maturation antigen (BCMA) is a suitable target for chimeric antigen receptor (CAR)-expressing T cells, and adoptive transfer of anti-BCMA-CAR-expressing T cells is a promising new strategy for treating multiple myeloma. PMID: 23344265
  20. B-cell maturation antigen (BCMA), an essential membrane protein for maintaining the survival of plasma cells, was identified as a glycoprotein exhibiting complex-type N-glycans at a single N-glycosylation site, asparagine 42. PMID: 23776238
  21. the effect of APRIL is mediated via BCMA, which does not activate the classical NF-kappaB pathway, whereas it induces a novel signaling pathway, which involves JNK2 phosphorylation, FOXO3A activation, and GADD45 transcription PMID: 23071284
  22. Serum BCMA levels were higher among patients with progressive disease than those with responsive disease. Overall survival was shorter among patients whose serum BCMA levels were above the median. PMID: 22804669
  23. TNFRSF17 may be a candidate gene associated with the pathogenesis of colon cancer. PMID: 22108903
  24. These data advance BCMA as an inflammation-related TNF superfamily member in keratinocytes, of potential importance in the management of inflammatory skin conditions. PMID: 22166983
  25. primary leukemia B-cell precursors aberrantly express receptors of the BAFF-system, BAFF-R, BCMA, and TACI PMID: 21687682
  26. This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma. PMID: 21483105
  27. Signaling through BCMA enhances B cell activation following exposure to TLR9 agonists, and increased expression in SLE may contribute to the production of IgG autoantibodies. PMID: 21250838
  28. genetic polymorphisms are associated with gastrointestinal disorders PMID: 20016944
  29. Expression of BCMA, TACI, and BAFF-R by multiple myeloma cells support cell growth and survival. PMID: 14512299
  30. APRIL.TACI_d2 and APRIL.BCMA complexes together reveal the mechanism by which TACI engages high affinity ligand binding through a single cysteine-rich domain PMID: 15542592
  31. BCMA is a target of donor B-cell immunity in patients with myeloma who respond to Donor lymphocyte infusions PMID: 15692072
  32. Review. APRIL interactions with BCMA likely govern memory B cell populations. PMID: 16919470
  33. Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation. PMID: 16931039
  34. The BCMA inhibited HRS cell accumulation in vitro and might attenuate HL expansion in vivo. PMID: 16960154
  35. BCMA TVs were observed only in some CD19+ cell samples. PMID: 17825416
  36. rheumatoid arthritis fibroblast like synoviocytes are stimulated by APRIL and express the APRIL receptor BCMA PMID: 17968879
  37. Expression of B cell maturation Ag (BCMA) is also highly regulated and we demonstrate that BCMA expression is only acquired in MB cells and in a manner accompanied by loss of BAFF-R expression. PMID: 18025170
  38. we observed APRIL expression, together with TACI and BCMA in gut-associated lymphoid tissue, lamina propria, and in the epithelium of stomach, small and large intestine, and rectum. PMID: 19741596

Show More

Hide All

Involvement in disease
A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.
Subcellular Location
Cell membrane; Single-pass type III membrane protein. Endomembrane system; Single-pass type III membrane protein. Note=Perinuclear Golgi-like structures.
Tissue Specificity
Expressed in mature B-cells, but not in T-cells or monocytes.
Database Links

HGNC: 11913

OMIM: 109545

KEGG: hsa:608

STRING: 9606.ENSP00000053243

UniGene: Hs.2556

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*