Code | CSB-MP023974HU1 |
Size |
US$368Purchase it in Cusabio online store (only available for customers from the US) |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) is a partial-length receptor produced in mammalian cells. A DNA sequence encoding the TNFRSF17 (1-54aa) was fused with an Fc-tag at C-terminal. Recombinant TNFRSF17 finds applications in studies involving cancer cells. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | ①Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 10 μg/ml can bind human BCMA, the EC50 of human BCMA protein is 221.3-298.6 ng/ml. ③Human TNFSF13B protein Fc tag (CSB-MP897523HU1) captured on COOH chip can bind Human BCMA protein Fc tag (CSB-MP023974HU1) with an affinity constant of 39 nM as detected by LSPR Assay.④Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B), the EC50 is 0.1752-0.3657 ng/ml. |
Target Names | TNFRSF17 |
Uniprot No. | Q02223 |
Research Area | Cancer |
Alternative Names | B cell maturation antigen; B cell maturation factor; B cell maturation protein; B-cell maturation protein; BCM; BCMA; CD269; CD269 antigen; TNFRSF17; TNR17_HUMAN; Tumor necrosis factor receptor superfamily member 17 |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 1-54aa |
Target Protein Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
Mol. Weight | 34.8 kDa |
Protein Length | Partial |
Tag Info |
C-terminal hFc-tagged |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
|
Gene References into Functions |
|
Involvement in disease | A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2. |
Subcellular Location | Cell membrane; Single-pass type III membrane protein. Endomembrane system; Single-pass type III membrane protein. Note=Perinuclear Golgi-like structures. |
Tissue Specificity | Expressed in mature B-cells, but not in T-cells or monocytes. |
Database Links |
HGNC: 11913 OMIM: 109545 KEGG: hsa:608 STRING: 9606.ENSP00000053243 UniGene: Hs.2556 |