Recombinant Macaca fascicularis Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active)

In Stock
Code CSB-MP7005MOV
Abbreviation Recombinant Cynomolgus monkey TNFRSF1A protein, partial (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TNFRSF1A at 2 μg/ml can bind Human TNF(CSB-MP023955HUk7-B). The EC50 is 10.33-12.16 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TNFRSF1A at 2 μg/mL can bind Human TNF(CSB-MP023955HUk7-B). The EC50 is 10.33-12.16 ng/mL.
Target Names
Uniprot No.
Alternative Names
Tumor necrosis factor receptor 1 ; Tumor necrosis factor receptor type I; p55 ; p60; TNFRSF1A
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
30-211aa
Target Protein Sequence
LVPPLRDREKRDSVCPQGKYIHPQNNSVCCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRYYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKTLECTKLCLPQTENVKGTEDSGTT
Mol. Weight
49.5 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TNFR1 mediates the pleiotropic effects of TNF-α in inflammation, apoptosis, and immune regulation, making it a critical target in cancer immunology and therapeutic antibody development. This recombinant cynomolgus monkey TNFRSF1A, spanning the extracellular ligand-binding domain (residues 30–211), demonstrates quantifiable binding to human TNF with an EC50 of 10.33–12.16 ng/mL in functional ELISA, confirming that mammalian expression preserves the native conformational epitopes required for high-affinity ligand recognition. The validated activity supports use in ligand-binding assays, competitive inhibition screens for TNF-blocking biologics, and therapeutic antibody epitope mapping where cross-reactivity between human and cynomolgus orthologs must be characterized for preclinical safety studies. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for SPR affinity characterization, biolayer interferometry kinetics, and antibody screening workflows in oncology drug discovery.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*