Purity

Greater than ≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TNFRSF1A at 2 μg/mL can bind Human TNF(CSB-MP023955HUk7-B). The EC50 is 10.33-12.16 ng/mL.

Target Names

TNFRSF1A

Uniprot No.

A0A7N9CVF2

Alternative Names

Tumor necrosis factor receptor 1 ; Tumor necrosis factor receptor type I; p55 ; p60; TNFRSF1A

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

30-211aa

Target Protein Sequence

LVPPLRDREKRDSVCPQGKYIHPQNNSVCCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRYYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKTLECTKLCLPQTENVKGTEDSGTT

Mol. Weight

49.5 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TNFR1 mediates the pleiotropic effects of TNF-α in inflammation, apoptosis, and immune regulation, making it a critical target in cancer immunology and therapeutic antibody development. This recombinant cynomolgus monkey TNFRSF1A, spanning the extracellular ligand-binding domain (residues 30–211), demonstrates quantifiable binding to human TNF with an EC50 of 10.33–12.16 ng/mL in functional ELISA, confirming that mammalian expression preserves the native conformational epitopes required for high-affinity ligand recognition. The validated activity supports use in ligand-binding assays, competitive inhibition screens for TNF-blocking biologics, and therapeutic antibody epitope mapping where cross-reactivity between human and cynomolgus orthologs must be characterized for preclinical safety studies. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for SPR affinity characterization, biolayer interferometry kinetics, and antibody screening workflows in oncology drug discovery.

Code	CSB-MP7005MOV
Abbreviation	Recombinant Cynomolgus monkey TNFRSF1A protein, partial (Active)
MSDS	MSDS Datasheet
Size	$190
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TNFRSF1A at 2 μg/ml can bind Human TNF(CSB-MP023955HUk7-B). The EC₅₀ is 10.33-12.16 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage