Home
Active Protein
Other
Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active)

Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active)

^{In Stock} ^Promotion

Code	CSB-YP4607MOV
Abbreviation	Recombinant Cynomolgus monkey LY6G6D protein (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC₅₀ is 3.963-7.154 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 3.963-7.154 ng/mL.

Target Names

LY6G6D

Uniprot No.

UJY53414.1

Molecular Characterization

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Yeast

Expression Region

20-104aa

Target Protein Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS

Mol. Weight

11.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

LY6G6D has emerged as a compelling immunotherapy target in oncology, and this cynomolgus monkey ortholog (residues 20–104, representing the full mature protein) enables critical cross-reactive antibody screening and preclinical validation studies. Binding activity is confirmed by functional ELISA, where immobilized protein at 2 μg/mL engages an anti-LY6G6D recombinant antibody with an EC50 of 3.963–7.154 ng/mL, supporting use in antibody development campaigns, epitope binning, and species cross-reactivity assessments. Yeast-based expression preserves eukaryotic folding of the LY6/uPAR domain while the N-terminal 6×His tag facilitates oriented immobilization on biosensor surfaces for kinetic binding assays. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for functional cell-based assays evaluating antibody-dependent cytotoxicity or complement activation in NHP-relevant preclinical models.