Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active)

In Stock
Code CSB-YP4607MOV
Abbreviation Recombinant Cynomolgus monkey LY6G6D protein (Active)
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 3.963-7.154 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 3.963-7.154 ng/mL.
Target Names
Uniprot No.
Molecular Characterization
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Yeast
Expression Region
20-104aa
Target Protein Sequence
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS
Mol. Weight
11.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

LY6G6D has emerged as a compelling immunotherapy target in oncology, and this cynomolgus monkey ortholog (residues 20–104, representing the full mature protein) enables critical cross-reactive antibody screening and preclinical validation studies. Binding activity is confirmed by functional ELISA, where immobilized protein at 2 μg/mL engages an anti-LY6G6D recombinant antibody with an EC50 of 3.963–7.154 ng/mL, supporting use in antibody development campaigns, epitope binning, and species cross-reactivity assessments. Yeast-based expression preserves eukaryotic folding of the LY6/uPAR domain while the N-terminal 6×His tag facilitates oriented immobilization on biosensor surfaces for kinetic binding assays. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for functional cell-based assays evaluating antibody-dependent cytotoxicity or complement activation in NHP-relevant preclinical models.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*