Recombinant Mouse Atrial natriuretic peptide receptor 1 (Npr1), Partial

In Stock
Code CSB-MP016023MO
Abbreviation Recombinant Mouse NPR1 protein, partial
MSDS
Size $318
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Target Names
Uniprot No.
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
29-469aa
Target Protein Sequence
SDLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPLGYPPPDIPKCGFDNEDPACNQDHFSTLE
Mol. Weight
50.6kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.
Gene References into Functions
  1. A decreased Npr1 copy number enhanced the expression of hypertrophic markers. PMID: 27199456
  2. The results indicate that the inhibition of NPRA suppresses gastric cancer development and targeting NPRA may represent a promising strategy for the treatment of gastric cancer. PMID: 27634171
  3. KLF10 and atrial natriuretic peptide/NPRA in exerting influences on chronic pulmonary disease pathogenesis PMID: 27592451
  4. Treatment of the haplotype Npr1(+/-) mice with histone deacetylase inhibitors significantly lowered blood pressure and reduced the renal inflammation and fibrosis involving the interactive roles of HDAC1/2, NF-kappaB (p65), and STAT1. PMID: 28566502
  5. The results suggest that an antagonistic cascade exists between the TGF-beta1/Smad/deltaEF1 pathways and Npr1 expression and receptor signaling that is relevant to renal and vascular remodeling, and may be critical in the regulation of blood pressure and cardiovascular homeostasis. PMID: 26934489
  6. Conclude that postnatal cardiac hyperplasia in mice with global GC-A inactivation is provoked by systemic alterations rather than direct regulation of cardiac myocyte proliferation. PMID: 26059418
  7. Suggest that the FQQI motif is essential for the internalization and subcellular trafficking of NPRA during the hormone signaling process in intact mesangial cells. PMID: 26377794
  8. Data suggest activation of skeletal muscle (SM) Npra is important for maintenance of long-term insulin sensitivity; up-regulation of Npra signal transduction in SM (that was reduced by obesity) prevents glucose intolerance and diabetes type 2. PMID: 26253614
  9. these findings define a novel epigenetic regulatory mechanism that governs Npr1 gene transcription. PMID: 24451378
  10. Npr1 represses the expression of cardiac proinflammatory mediators, hypertrophic markers, and NF-kappaB/AP-1-mediated mechanisms, which seem to be associated in an Npr1 gene-dose-dependent manner PMID: 24424043
  11. ANP is capable of attenuating agonist-induced lung edema in the absence of NPR-A. PMID: 23195629
  12. These results demonstrate that a high-salt diet aggravates cardiac ANG II, aldosterone and pro-inflammatory cytokine levels in Npr1 gene-disrupted 1-copy mice, whereas, in Npr1 gene-duplicated (3-copy and 4-copy) mice, high salt did not render such elevation, suggesting the potential roles of Npr1 against salt loading. PMID: 23188418
  13. ANP-NPRA system exerts an inhibitory effect on MAPKs and down-stream effector molecules, AP-1, and CREB, critical for cell growth and proliferation. PMID: 22610792
  14. Natriuretic peptide receptor guanylyl cyclase-A protects podocytes from aldosterone-induced glomerular injury. PMID: 22652704
  15. Results demonstrate the opposite effects of NPR-A and NPR-C in LPS-mediated endothelial permeability and lung injury. PMID: 22001395
  16. Data suggest that a NPPA gradient originating in the oviduct induces sperm chemotaxis by binding to its receptor NPR1 and then activating PKG pathway, and plays a physiological role in fertilization. PMID: 21809340
  17. Cellular exposure to Go6976 reduced basal and natriuretic peptide-dependent, but not detergent-dependent, GC-A and GC-B activity. PMID: 21366551
  18. NPR-A regulates self-renewal and pluripotency of embryonic stem cells. PMID: 21390061
  19. Soluble guanylyl cyclase alpha1 subunit is important in penile erection in mice. PMID: 20098992
  20. The present results demonstrate that the disruption of Npr1 gene activates proinflammatory cytokines leading to fibrosis, hypertrophic growth, and remodeling of the kidneys of mutant mice. PMID: 20881240
  21. Trans retinoic acid activation of Npr1 gene transcription is mediated through binding of Ets-1 and Sp1 to the Npr1 promoter. PMID: 20864529
  22. Suggest that NPR-A activation by natriuretic peptides facilitates iNOS expression and contributes to the vascular dysfunction characteristic of endotoxic shock. PMID: 20649600
  23. results suggest that particulate matter and O3 exposures, alone and combined, lead to different cardiac functional changes, and these unique changes are age-specific and dependent on Nppa and Npr1 genes PMID: 20540624
  24. The ANP/GC-A system may have a modulating effect on beta-cell function. PMID: 20555029
  25. The Stria vascularis may be the most important place for ANP to regulate endolymph fluid balance via NPR-A. PMID: 20150880
  26. The ANP/NPR-A signaling pathway is upregulated in streptozotocin-induced diabetic mice, and contributes to the development of diabetic gastroparesis. PMID: 20039448
  27. Mice lacking a functional NPR-A receptor represent a useful model to study the role of the ANP system in alcohol-associated pathology. PMID: 19828462
  28. two distinct NPR-A phosphatase activities PMID: 11821394
  29. NPR1 is an atherosclerosis susceptibility locus and represents a potential link between atherosclerosis and cardiac hypertrophy. Npr1 has a role in regulation of hypertrophic cell growth. PMID: 12702516
  30. Results suggest a local function of the atrial natriuretic peptide receptor guanylyl cyclase-A system to moderate the molecular program of cardiac hypertrophy. PMID: 12727932
  31. NPRA activation is the predominant mechanism mediating the natriuretic, diuretic, and renal hemodynamic responses to acute blood volume expansion. PMID: 12824076
  32. NPRA receptor has a role in attenuating the effects of hypertrophic agents on cardiac wall thickness and in cardiac hypertrophy PMID: 14500707
  33. suggest that androgens contribute to gender-related differences in cardiac hypertrophy and fibrosis by a mechanism involving angiotensin II type 1A receptor (AT1A) receptors and guanylyl cyclase-A PMID: 14592959
  34. The combination of increased CaMKII activity and altered action potential characteristics facilitates ventricular arrhythmias in hypertrophic GC-A-/- hearts PMID: 15135664
  35. circulating ANP levels and data from NPR1(-/-) and NPR3(-/-) mice suggest that the ANP pathway may not be involved in the cardiovascular response to caloric restriction PMID: 15191892
  36. Acute renal and mean arterial pressure responses to atrial extracts require the NPRA receptor. PMID: 15337836
  37. ablation of NPRA/cGMP signaling activates NF-kappaB binding activity associated with hypertrophic growth of mutant mice hearts PMID: 15629436
  38. ATP does not activate NPRA and NPRB as has been repeatedly reported. Instead, ATP increases activity primarily by maintaining proper receptor phosphorylation status but also serves a previously unappreciated enzyme stabilizing function. PMID: 15911610
  39. Guanylyl cyclase-A activation by endogenous cardiac natriuretic peptides protects against acute heart failure and attenuates chronic cardiac remodeling after myocardial infarction, mediated partly through inhibition of renin-angiotensin system. PMID: 15998711
  40. Enhanced activity of the myocardial Na+/H+ exchanger NHE-1 moderates the cardiac growth response to pressure overload in atrial natriuretic peptide receptor-deficient mice. PMID: 16216978
  41. Ets-1 greatly stimulates Npr1 gene promoter activity, implicating its critical role in the regulation and function of NPRA at the molecular level PMID: 16517010
  42. ANG II-dependent transcriptional repression of Npr1 gene promoter activity and down-regulation of GC activity of translated protein, NPRA, is regulated by PKC pathways PMID: 16930545
  43. Reduced NPR-A protein levels, not receptor dephosphorylation, explain the renal hyporesponsiveness to natriuretic peptides in congestive heart failure. PMID: 17264312
  44. Findings provide direct evidence that ablation of NPRA/cGMP signaling activates inflammatory cytokines, probably via NF-kappaB mediated signaling pathway, and is associated with hypertrophic growth of null mutant hearts. PMID: 17267074
  45. Mediates cardiomegaly by its effect on two different gene pathways. PMID: 17293444
  46. increased adrenal ANG II and Aldo levels lead to renal and vascular injury in Npr1 gene-disrupted mice PMID: 17389676
  47. Disruption of NPRA/cGMP signaling leads to the augmented expression of cardiac renin-angiotensin pathways causing cardiac hypertrophy and remodeling. PMID: 17566078
  48. ATP is not required for the initial activation of natriuretic peptide receptor A and B, but does increase activity over time by reducing the apparent K(m) for GTP. PMID: 17848634
  49. These results suggest that NPRA is involved in tumor angiogenesis. PMID: 18172317
  50. Lung ischemia reperfuion injury triggers atrial natriuretic peptide release and alters endothelial signaling to activate NPR-A. PMID: 18223163

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Adenylyl cyclase class-4/guanylyl cyclase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*