Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Mertk at 2 μg/mL can bind anti-MERTK recombinant antibody(CSB-RA621519A1HU), the EC50 is 19.22-25.80 ng/mL.
Alternative Names
(Proto-oncogene c-Mer)(Receptor tyrosine kinase MerTK)
Molecular Characterization
Species
Mus musculus (Mouse)
Expression Region
19-497aa
Target Protein Sequence
GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSM
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Mouse Mertk recombinant protein was produced in Mammalian cell, where the gene sequence encoding Mouse Mertk (19-497aa) was expressed with the C-terminal 10xHis tag. The purity of this Mertk protein was greater than 95% by SDS-PAGE. The activity has been validated.
The mouse Mertk gene encodes a single-pass transmembrane protein with a relative molecular mass of about 110 KDa containing 994 amino acids. Mertk is a member of the receptor tyrosine kinase family, which is expressed in many tissues of the human body and participates in various physiological functions. Mertk is an important target in tumor therapy. Mertk reduces the phosphorylation levels of MAPK/ERK and PI3K/Akt, down-regulates the expression of BcH-2 protein, increases the cleavage of apoptosis-related protein caspase-3, and promotes cell apoptosis. The results of Twokoski et al. showed that Mertk could regulate the proliferation of melanoma cells by reducing the activation of Akt pathway and attenuating the activation of downstream signaling mammalian target of rapamycin and ribosomal protein S6 kinase, but had no significant effect on the activation of ERK pathway, suggesting that the effect of Mertk on melanoma proliferation is an Akt-dependent manner. Studies have shown that Mertk inhibitors can reduce glioblastoma cell adhesion, transform the cytoskeleton, and inhibit cell migration by up-regulating focal adhesion kinase phosphorylation and Ras homologous G protein activation.