Recombinant Shigella flexneri Glutaredoxin-4 (grxD)

In Stock Promotion
Code CSB-EP364758SZB
Size US$388
Order now
Promotion
Promotional price as low as $99
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364758SZB could indicate that this peptide derived from E.coli-expressed Shigella flexneri grxD.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364758SZB could indicate that this peptide derived from E.coli-expressed Shigella flexneri grxD.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
grxD
Uniprot No.
Research Area
Cell Biology
Alternative Names
grxD; ydhD; SF1682; S1814Glutaredoxin 4; Grx4; Monothiol glutaredoxin
Species
Shigella flexneri
Source
E.coli
Expression Region
1-115aa
Target Protein Sequence
MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
28.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Shigella flexneri grxD protein was made through genetic engineering. By putting the grxD gene into the genetic material of E.coli cell, the E.coli could be used as factories or producers to make the desired grxD protein for research uses. The expression region of this protein is at 1-115aa. N-terminal 6xHis-SUMO tag was used in the expression process. The purity is 85%+ determined by SDS-PAGE.

The cytosolic monothiol glutaredoxin GrxD plays a role in adaptation to iron starvation during infection. GrxD is repressed by the transcription factor SreA in iron replete conditions. During iron starvation, GrxD displays predominant nuclear localization. Downregulation of GrxD expression results in de-repression of genes involved in iron-dependent pathways and repression of genes involved in iron acquisition during iron starvation, but did not significantly affect these genes during iron sufficiency. GrxD displays protein-protein interaction with components of the cytosolic iron-sulfur cluster biosynthetic machinery, indicating a role in this process, and with the transcription factors SreA and HapX, which mediate iron regulation of iron acquisition and iron-dependent pathways. There is a GrxD-independent mechanism for sensing iron sufficiency by HapX. Inactivation of SreA suppresses the lethal effect caused by GrxD inactivation. Taken together, this study demonstrates that GrxD is crucial for iron homeostasis in A. fumigatus.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can you tell me what strain of this E coli expressed recombinant protein is made in?

A:
Thanks for your inquiry. This recombinant protein is made in Rosetta strain of E coli.

Target Background

Function
Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.
Subcellular Location
Cytoplasm.
Protein Families
Glutaredoxin family, Monothiol subfamily
Database Links

KEGG: sfl:SF1682

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*