Recombinant Escherichia coli Heat-labile enterotoxin A chain(eltA)

In Stock
Code CSB-EP356922ENL
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P06717
Lead Time 3-7 business days
Relevance The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli
Purity Greater than 85% as determined by SDS-PAGE.
Sequence NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Research Area others
Source E.coli
Gene Names eltA
Protein Names LT-A, porcine LTP-A
Expression Region 19-258aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 32.8 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Protein Families Enterotoxin A family

Related Products

eltA Antibodies

eltA Antibodies for Escherichia coli

eltA Antibodies for Escherichia coli

eltA Proteins

eltA Proteins for Escherichia coli

eltA Proteins for Escherichia coli

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.