Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

eaeA

Uniprot No.

P52869

Research Area

Microbiology

Alternative Names

eaeA; eae; Intimin; Attaching and effacing protein; Outer membrane protein; Fragment

Species

Hafnia alvei

Source

E.coli

Expression Region

1-280aa

Target Protein Sequence

ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

46.1kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Hafnia alvei eaeA contains amino acids 1-280. The expected molecular weight for the eaeA protein is calculated to be 46.1 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of eaeA, which enables a simple process of detecting and purifying the eaeA recombinant protein in the following steps.

The Hafnia alvei intimin, encoded by the eaeA gene, is a virulence factor that mediates the intimate adherence of the bacterium to the host cells, leading to localized alterations in the host cell cytoskeleton and the formation of characteristic attaching and effacing lesions. Intimin is often associated with gastrointestinal infections and is implicated in the pathogenesis of diseases such as diarrhea. Understanding the role of the Hafnia alvei intimin is important for studying the pathogenic mechanisms of this bacterium and for developing strategies to prevent and treat infections associated with Hafnia alvei.

Target Background

Function

Necessary for the production of attaching and effacing lesions on tissue culture cells.

Subcellular Location

Cell outer membrane; Single-pass membrane protein.

Protein Families

Intimin/invasin family

Code	CSB-EP346794HAQ
Abbreviation	Recombinant Hafnia alvei eaeA protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Hafnia alvei Intimin (eaeA)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage