Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17(IAA17)

In Stock
Code CSB-EP308638DOA
Product Type Recombinant Protein
Size US$2466
Uniprot No. P93830
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA
Research Area Cell Biology
Source E.coli
Gene Names IAA17
Protein Names Recommended name: Auxin-responsive protein IAA17 Alternative name(s): Auxin response 3 Indoleacetic acid-induced protein 17
Expression Region 1-229aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 32.3 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.
Subcellular Location Nucleus
Protein Families Aux/IAA family
Database Links

KEGG: ath:AT1G04250

STRING: 3702.AT1G04250.1

UniGene: At.20252

Related Products

IAA17 Antibodies

IAA17 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

IAA17 Proteins

IAA17 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.