Recombinant Bartonella henselae Probable periplasmic serine endoprotease DegP-like (htrA)

In Stock
Code CSB-EP345817BSG
Abbreviation Recombinant Bartonella henselae htrA protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
htrA
Uniprot No.
Research Area
Others
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1) (Rochalimaea henselae)
Source
E.coli
Expression Region
19-503aa
Target Protein Sequence
LETALFFSGCGSSLWTTKAHANSVFSSLMQQQGFADIVSQVKPAVVSVQVKSNKKKKEWFFSDFFSTPGFDQLPDQHPLKKFFQDFYNRDKPSNKSLQRSHRLRPIAFGSGFFISSDGYIVTNNHVISDGTSYAVVLDDGTELNAKLIGTDPRTDLAVLKVNEKRKFSYVDFGDDSKLRVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGTGVYDDFIQIDAAVNRGNSGGPTFDLNGKVVGVNTAIFSPSGGNVGIAFAIPAATAKQVVQQLIEKGLVQRGWLGVQIQPVTKEISDSIGLKEAKGALITDPLKGPAAKAGIKAGDVIISVNGEKINDVRDLAKRIANMSPGETVTLGVWKSGKEENIKVKLDSMPEDENMKDGSKYSNEHGNSDETLEDYGLIVAPSDDGVGLVVTDVDPDSDAADKGIRPGDVIVTVNNKSVKKVSDITDTIKNAQKLGRKAILLQVRTNDQNRFVALPIFKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
59.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bartonella henselae Probable periplasmic serine endoprotease DegP-like (htrA) is expressed in E. coli, spanning amino acids 19-503 of the mature protein. This product carries an N-terminal 10xHis-tag and a C-terminal Myc-tag for streamlined purification and detection. The protein achieves greater than 85% purity, as confirmed by SDS-PAGE, which appears to provide high-quality material for research applications.

The DegP-like serine endoprotease from Bartonella henselae likely plays a crucial role in protein quality control within the periplasmic space. It's involved in degrading misfolded proteins and maintaining cellular homeostasis, functioning as part of the serine protease family. This protein has drawn research interest particularly in studies of bacterial proteolytic processes and stress response mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Bartonella henselae HtrA protein is expressed in E. coli, a prokaryotic system that is generally suitable for producing bacterial proteins like HtrA. As a bacterial protein expressed in its native prokaryotic environment, the probability of proper folding is relatively high. HtrA is a serine protease/chaperone that requires precise folding for its proteolytic and chaperone functions. The protein is expressed as the mature form (19-503aa) with dual tags (N-terminal 10xHis and C-terminal Myc) and >85% purity. However, HtrA proteins typically form complex oligomeric structures (usually hexamers) and require proper active site formation for protease activity. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its proteolytic activity and oligomeric state.

1. Antibody Development and Immunological Studies

The recombinant HtrA can serve as an effective immunogen for generating antibodies that recognize linear epitopes. The dual tags facilitate purification and detection. However, antibodies may not recognize conformational epitopes of properly oligomerized native HtrA. Validation against native HtrA from B. henselae is recommended.

2. Protein-Protein Interaction Studies

This application requires caution. While the tags enable technical feasibility for pull-down assays, if HtrA is misfolded or improperly oligomerized, it may not interact physiologically with true substrates or binding partners. HtrA requires proper oligomerization for its chaperone functions and substrate recognition. This application should only be pursued after confirming proper folding and oligomeric state.

3. Comparative Biochemical Analysis

This application is well-suited but requires validation. Basic biochemical characterization is feasible, but comparative studies with HtrA homologs require proper folding to yield valid evolutionary and functional insights. The protein's oligomeric state and stability should be confirmed before meaningful comparisons can be made.

4. ELISA-Based Detection Assays

This application is appropriate for detection purposes. The dual tags enable technical development of ELISA formats for antibody detection. However, if the HtrA protein is misfolded, conformational epitopes may not be properly presented, potentially affecting detection sensitivity for antibodies targeting discontinuous epitopes.

Final Recommendation & Action Plan

Given that this is a bacterial protein expressed in a prokaryotic system, the probability of proper folding is relatively high. However, we recommend first validating the HtrA protein's proteolytic activity using known HtrA substrates and confirming its oligomeric state through size-exclusion chromatography with multi-angle light scattering. Antibody development can proceed as the safest application. For interaction studies and comparative analyses, await validation of proper folding and oligomerization. Always include appropriate controls such as protease inhibitors and known substrates in activity assays. If proper folding and activity are confirmed, the protein becomes suitable for all described applications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Could be efficient in the degradation of transiently denatured and unfolded proteins which accumulate in the periplasm following stress conditions.
Subcellular Location
Periplasm.
Protein Families
Peptidase S1C family
Database Links

KEGG: bhe:BH04770

STRING: 283166.BH04770

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*