Recombinant Bombyx mori Prothoracicotropic hormone

Code CSB-EP324609BTT
Abbreviation Recombinant Bombyx mori Prothoracicotropic hormone protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
; Prothoracicotropic hormone; PTTH) [Cleaved into: P2K; P6K; Prothoracicotropic hormone]
Species
BOMMO(Silk moth)
Source
E.coli
Expression Region
116-224aa
Target Protein Sequence
GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.; Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions.
Gene References into Functions
  1. HR38 is a prothoracicotropic hormone(PTTH)-stimulated immediate early gene that is, at least in part, induced through Ca(2+)/ERK and PI3K signaling. The present study proposes a potential cross talk mechanism between PTTH and ecdysone signaling to regulate insect development and lays a foundation for a better understanding of the mechanisms of PTTH's actions. PMID: 27090809
  2. There are interconnections among Ca(2+) signaling, adenosine 5'-monophosphate-activated protein kinase, and 4E-BP phosphorylation in in prothoracicotropic hormone (PTTH-activated prothoracic glands of Bombyx mori. PMID: 27751888
  3. Study reports the physical basis of neurohormone PTTH sensing by the receptor tyrosine kinase Torso. Hormone binding by Torso is asymmetric and anticooperative, allowing receptor levels to determine the nature of signal transduction. PMID: 26698662
  4. To examine the expression of Rab proteins and neuropeptide hormones in the brain of the silkworm, Bombyx mori.The Rab1 co-localized with prothoracicotropic hormone. PMID: 22922733
  5. PTTH/PI3K/TOR/4E-BP (S6K) signaling is involved in PTTH-stimulated ecdysteroidogenesis by prothoracic glands. PMID: 22227406
  6. The authors showed that Bombyx mori prothoracicotropic hormone (PTTH)-stimulated ecdysteroidogenesis was partially blocked by LY294002 and wortmannin, indicating that phosphoinositide 3-kinase (PI3K) is involved in PTTH-stimulated ecdysteroidogenesis. PMID: 21199670
  7. Study showed that prothoracicotropic hormone (PTTH) stimulates a rapid increase in tyrosine phosphorylation of at least 2 proteins in prothoracic glands: extracellular signal-regulated kinase and a 120-kDa protein. PMID: 20568296
  8. the TATA box is involved in regulation of PTTH gene expression in B. mori PMID: 20563654
  9. PTTH-stimulated ERK phosphorylation is only partially Ca(2+)- and calmodulin-dependent, and HNMPA-(AM)(3)-sensitive receptor tyrosine kinase is involved in activation of ERK phosphorylation by PTTH. PMID: 19800889

Show More

Hide All

Tissue Specificity
PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain.
Database Links

KEGG: bmor:692767

UniGene: Bmo.125

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*