Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
prn; omp69A; BP1054; Pertactin autotransporter; P.93) [Cleaved into: Outer membrane protein P.69; Pertactin translocator]
Species
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Expression Region
632-910aa
Target Protein Sequence
ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 632-910 constitute the expression domain of recombinant Bordetella pertussis prn. The calculated molecular weight for this prn protein is 45.8 kDa. The prn protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of prn, which enables a simple process of detecting and purifying the prn recombinant protein in the following steps.
The pertactin (Prn) is an autotransporter that plays a crucial role in the adhesion of B. pertussis to respiratory epithelial cells and contributes to the bacterium's ability to colonize the respiratory tract. Prn is synthesized as a single polypeptide chain and then transported across the bacterial outer membrane to the cell surface. Once on the bacterial surface, Prn functions as an adhesin, facilitating the attachment of B. pertussis to host cells. In addition to its role in adhesion, Prn is one of the antigens included in some acellular pertussis vaccines. Understanding the function and variability of the Prn autotransporter is crucial for developing effective pertussis vaccines and gaining insights into the pathogenic mechanisms of Bordetella pertussis.
