Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

prn

Uniprot No.

P14283

Research Area

Others

Alternative Names

prn; omp69A; BP1054; Pertactin autotransporter; P.93) [Cleaved into: Outer membrane protein P.69; Pertactin translocator]

Species

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Source

E.coli

Expression Region

632-910aa

Target Protein Sequence

ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

45.8kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 632-910 constitute the expression domain of recombinant Bordetella pertussis prn. The calculated molecular weight for this prn protein is 45.8 kDa. The prn protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of prn, which enables a simple process of detecting and purifying the prn recombinant protein in the following steps.

The pertactin (Prn) is an autotransporter that plays a crucial role in the adhesion of B. pertussis to respiratory epithelial cells and contributes to the bacterium's ability to colonize the respiratory tract. Prn is synthesized as a single polypeptide chain and then transported across the bacterial outer membrane to the cell surface. Once on the bacterial surface, Prn functions as an adhesin, facilitating the attachment of B. pertussis to host cells. In addition to its role in adhesion, Prn is one of the antigens included in some acellular pertussis vaccines. Understanding the function and variability of the Prn autotransporter is crucial for developing effective pertussis vaccines and gaining insights into the pathogenic mechanisms of Bordetella pertussis.

Target Background

Function

Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough.

Gene References into Functions

Prn-KO strains induced an increased production of pro-inflammatory cytokines by human and murine dendritic cell. PMID: 29559630
Multiple driving forces required for efficient secretion of autotransporter virulence proteins, such as pertactin. PMID: 25670852
Results indicate that the purified pertactin is a potential candidate as immunogen for preparation of diagnostic reagents and as a vaccine component. PMID: 20306653

Subcellular Location

[Pertactin autotransporter]: Periplasm.; [Outer membrane protein P.69]: Secreted. Cell surface.; [Pertactin translocator]: Cell outer membrane; Multi-pass membrane protein. Note=The cleaved C-terminal fragment (autotransporter domain) is localized in the outer membrane.

Database Links

KEGG: bpe:BP1054

STRING: 257313.BP1054

Code	CSB-EP321224BUA
Abbreviation	Recombinant Bordetella pertussis Pertactin autotransporter protein, partial
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage