Recombinant Bovine Odorant-binding protein

In Stock
Code CSB-BP362133BO
Abbreviation Recombinant Bovine Odorant-binding protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Odorant-binding protein; OBP; Olfactory mucosa pyrazine-binding protein
Species
Bos taurus (Bovine)
Source
Baculovirus
Expression Region
1-159aa
Target Protein Sequence
AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine Odorant-binding Protein is expressed in a baculovirus system and includes an N-terminal 10xHis-tag for easy purification. The protein is produced as a full-length sequence from amino acids 1 to 159 and achieves a purity level greater than 85% as determined by SDS-PAGE analysis. This product is designed for research use only and provides reliable performance in various experimental applications.

Odorant-binding proteins from Bos taurus appear to play a critical role in the olfactory system by binding and transporting volatile odor molecules. These proteins seem essential in the initial steps of odor detection and signal transduction. This makes them an intriguing subject of study in olfactory research and the broader field of sensory biology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The baculovirus expression system provides proper eukaryotic folding machinery, increasing the likelihood of correct folding for this soluble protein. However, odorant-binding proteins require specific conformational structures for ligand binding activity. While the full-length sequence and eukaryotic expression system suggest favorable folding prospects, the actual folding status and functional capacity for odorant binding cannot be guaranteed without experimental validation. The protein may be correctly folded but still lack activity due to subtle structural variations.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

This application's validity depends entirely on correct protein folding. A properly folded odorant-binding protein could identify physiological interaction partners. However, if misfolded, it may yield non-specific binding or fail to recognize genuine partners, making data interpretation unreliable without independent structural validation.

2. Antibody Development and Validation

This recombinant protein serves as an excellent immunogen for antibody production. The full-length sequence ensures comprehensive epitope coverage. Even if misfolded, it will generate antibodies against linear epitopes useful for Western blotting. If correctly folded, it may additionally produce antibodies recognizing conformational epitopes on the native protein.

3. Biochemical Characterization and Stability Studies

This application is essential for determining the protein's physical properties. Techniques like size-exclusion chromatography and circular dichroism can assess oligomeric state, folding quality, and thermal stability, providing critical data on whether the protein is correctly structured. These studies directly address the folding uncertainty and provide fundamental data needed to evaluate the protein's suitability for functional applications.

4. Comparative Protein Analysis Across Species

This protein can serve as a standardized reference for cross-species comparisons. It enables structural comparisons through techniques like Western blotting and immunological cross-reactivity studies, providing insights into evolutionary relationships within the odorant-binding protein family.

Final Recommendation & Action Plan

The unknown folding status necessitates a sequential validation approach. The immediate priority should be Application 3 (Biochemical Characterization) to assess protein folding and stability through biophysical methods. If the protein demonstrates proper folding, it may be considered for Application 1 (Interaction Studies) with appropriate controls. Regardless of folding results, Applications 2 and 4 (Antibody Development and Comparative Analysis) can proceed confidently as they don't require functional validation. A functional odorant-binding assay should be conducted after confirming proper folding to fully characterize the protein's capabilities. This systematic approach ensures reliable data interpretation and appropriate resource allocation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This protein binds a wide variety of chemical odorants.
Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*