Recombinant Bovine Odorant-binding protein

Code CSB-YP362133BO
Product Type Recombinant Protein
Size US$3125
Uniprot No. P07435
Relevance This protein binds a wide variety of chemical odorants.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP362133BO could indicate that this peptide derived from Yeast-expressed Bos taurus (Bovine) N/A.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP362133BO could indicate that this peptide derived from Yeast-expressed Bos taurus (Bovine) N/A.
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Research Area Others
Source Yeast
Protein Names Olfactory mucosa pyrazine-binding protein
Expression Region 1-159aa
Tag Info Tag-Free
Mol. Weight 18.5 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein binds a wide variety of chemical odorants.
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Database Links

STRING: 9913.ENSBTAP00000022593

Related Products

Antibodies

Antibodies for Bos taurus (Bovine)

Proteins

Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.