Recombinant Bovine Odorant-binding protein

In Stock
Code CSB-YP362133BOa4
Abbreviation Recombinant Bovine Odorant-binding protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Odorant-binding protein; OBP; Olfactory mucosa pyrazine-binding protein
Species
Bos taurus (Bovine)
Source
Yeast
Expression Region
1-159aa
Target Protein Sequence
AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-sumostar-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Bovine Odorant-binding protein gets expressed in a yeast system and comes with an N-terminal 6xHis-sumostar tag that makes purification and detection much simpler. The complete protein covers amino acids 1 to 159. Purity appears to exceed 90% based on SDS-PAGE analysis. This product is meant for research use only and works well for different biochemical and structural studies that need high-purity protein.

Odorant-binding proteins (OBPs) are small, soluble proteins that transport odor molecules around. They seem to play a key role in how we detect and tell apart different smells by grabbing onto odorant molecules and helping move them to olfactory receptors. For researchers, OBPs matter because they help us figure out how smell works. Scientists can use them in studies about sensory biology and how molecules recognize each other.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant bovine odorant-binding protein (OBP) is unlikely to be correctly folded or fully bioactive for its native functions without further validation. OBP is a small soluble protein that requires precise tertiary structure to form a hydrophobic binding pocket for odorant molecules. The N-terminal 6xHis-SUMOstar tag (approximately 15-20 kDa) is substantially larger than the OBP domain (∼18 kDa) and may sterically hinder proper folding, particularly if the odorant-binding site is near the N-terminus. While the yeast expression system provides a eukaryotic environment that could support disulfide bond formation and solubility, the large fusion tag likely disrupts the native conformation. The purity >90% indicates low contaminants, but does not guarantee correct folding of the OBP domain. Without experimental validation (e.g., circular dichroism for secondary structure, fluorescence quenching assays for ligand binding), the protein's bioactivity remains uncertain.

This recombinant OBP is suitable for antibody generation, but antibodies will primarily target the immunodominant SUMOstar tag rather than OBP-specific epitopes. For antibodies recognizing native OBP conformations, the tag should be removed before immunization. As a standard in immunoassays, the tagged protein can work, but cross-reactivity with the tag must be controlled via tag-specific controls. Consistency is high, but specificity for OBP may be low.

To ensure reliable outcomes, first remove the SUMOstar tag using SUMO protease (if the construct includes a cleavage site) and purify the tag-free OBP; then validate folding using circular dichroism to confirm expected beta-rich secondary structure and fluorescence-based binding assays with known odorants (e.g., aldehydes or alcohols) to confirm bioactivity. If tag removal is not feasible, limit applications to tag-centric uses like anti-SUMOstar antibody development, and avoid quantitative functional studies. For structural work, always use tag-free protein and confirm homogeneity via size-exclusion chromatography. Incorporate controls for tag effects in all experiments to avoid misinterpretation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This protein binds a wide variety of chemical odorants.
Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*