Recombinant Bovine Odorant-binding protein

In Stock
Code CSB-YP362133BOb0
Product Type Recombinant Protein
Size US$335
Uniprot No. P07435
Lead Time 3-7 business days
Relevance This protein binds a wide variety of chemical odorants.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Research Area Others
Source Yeast
Gene Names N/A
Protein Names Olfactory mucosa pyrazine-binding protein
Expression Region 1-159aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 21.0 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein binds a wide variety of chemical odorants.
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Database Links

STRING: 9913.ENSBTAP00000022593

Related Products

N/A Antibodies

N/A Antibodies for Bos taurus (Bovine)

N/A Proteins

N/A Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.