Recombinant Bovine Beta-casein (CSN2)

^{In Stock}

Code	CSB-EP006063BO
Abbreviation	Recombinant Bovine CSN2 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CSN2

Uniprot No.

P02666

Research Area

Signal Transduction

Alternative Names

CSN2Beta-casein [Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin]

Species

Bos taurus (Bovine)

Source

E.coli

Expression Region

16-224aa

Target Protein Sequence

RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Explore the potential of dairy protein research with our recombinant bovine CSN2, a high-quality beta-casein protein sourced from Bos taurus (bovine) species. As an essential component of milk and a vital player in signal transduction pathways, beta-casein offers a valuable foundation for various research applications.

This full-length mature protein spans the expression region of 16-224aa and is produced in E.coli to ensure the highest level of purity and reliability. The N-terminal 10xHis and C-terminal Myc tags facilitate convenient purification and detection processes, while maintaining the protein's biological activity. With a purity of greater than 85% as determined by SDS-PAGE, our lyophilized powder format enables easy storage and reconstitution for your research needs.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Important role in determination of the surface properties of the casein micelles.; Casoparan acts as a macrophage activator, increasing the phagocytic activity of macrophages and peroxide release from macrophages. It also acts as a bradykinin-potentiating peptide.; Casohypotensin acts as a bradykinin-potentiating peptide. Induces hypotension in rats. Acts as a strong competitive inhibitor of endo-oligopeptidase A.; Antioxidant peptide has antioxidant activity.

Subcellular Location

Secreted.

Protein Families

Beta-casein family

Tissue Specificity

Mammary gland specific. Secreted in milk.

Database Links

STRING: 9913.ENSBTAP00000003409

UniGene: Bt.53272

Promotions