Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
CSN2Beta-casein [Cleaved into: Casoparan; Antioxidant peptide; Casohypotensin]
Species
Bos taurus (Bovine)
Expression Region
16-224aa
Target Protein Sequence
RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Explore the potential of dairy protein research with our recombinant bovine CSN2, a high-quality beta-casein protein sourced from Bos taurus (bovine) species. As an essential component of milk and a vital player in signal transduction pathways, beta-casein offers a valuable foundation for various research applications.
This full-length mature protein spans the expression region of 16-224aa and is produced in E.coli to ensure the highest level of purity and reliability. The N-terminal 10xHis and C-terminal Myc tags facilitate convenient purification and detection processes, while maintaining the protein's biological activity. With a purity of greater than 85% as determined by SDS-PAGE, our lyophilized powder format enables easy storage and reconstitution for your research needs.
