Recombinant Bovine Prolactin (PRL)

In Stock
Code CSB-YP018724BO
Abbreviation Recombinant Bovine PRL protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Prolactin
Alternative Names
PRL
Species
Bos taurus (Bovine)
Source
Yeast
Expression Region
31-229aa
Target Protein Sequence
TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Prolactin acts primarily on the mammary gland by promoting lactation.
Gene References into Functions
  1. Taken together, these results support novel functions of prolactin as a modulator of the innate immune response that do not involve the classical prolactin pathway. PMID: 26341952
  2. The presence and localization of prolactin receptor are consistent with expression data reported for other species, and the presence of PIP and prolactin in seminal fluid is consistent with data generated in humans. PMID: 25533929
  3. Functionally reciprocal mutations of the prolactin signaling pathway define hairy and slick cattle. PMID: 25519203
  4. The single nucleotide polymorphism rs42646708 of cattle XKR4 was significantly associated with serum prolactin concentrations and explained 2.45% of the phenotypic variation. PMID: 24666329
  5. Five mutations were identified in exonic region and eleven in associated intronic regions in PRL gene in 100 cattle from four Pakistani cattle breeds. PMID: 24065524
  6. this study identifies a biochemical mechanism for the regulation of SCFAs on bovine GH and PRL gene transcription in dairy cow anterior pituitary cells PMID: 24177567
  7. These data suggest that PRL protects brain endothelial cells against methamphetamine-induced toxicity PMID: 23988027
  8. Bovine prolactin improved the expression of human transferrin through such a possible mechanism that bovine prolactin activated STAT5a transcription expression. PMID: 22829284
  9. There was no significant difference between 1134 locus and milk performance traits of 5'-UTR of PRL gene PMID: 22207382
  10. Staphylococcus aureus infection inhibits nuclear factor kappa B activation mediated by prolactin in bovine mammary epithelial cells. PMID: 21843629
  11. Study of genetic variation in Yakutian cattle (Bos taurus L.) using the prolactin bPRL, growth hormone bGH, and transcription factor bPit-1 genes PMID: 20391788
  12. This is the second study reporting single nucleotide polymorphisms in the 5'-regulatory region of PRL gene, which interfere with milk production traits. PMID: 19714484
  13. evidence for a functional coupling between the PRL salt bridge and phosphorylation site indicates that either in vivo phosphorylation or specific mutations that destabilize the salt bridge impair biological activity. PMID: 12850287
  14. determination of the effects of exposure to different lengths of daylight during the dry period on circulating PRL and PRL receptor mRNA expression in lymphocytes and mammary tissue during the transition to lactation PMID: 15591374
  15. Expression of PRL and prolactin receptor (PRLR) mRNA is demonstrated for the first time in bovine corpus luteum throughout the luteal phase. PMID: 16435374
  16. The A-->G transition at position -1043 abolishes the recognition site for Hsp92II restriction endonuclease. PMID: 17929163
  17. Prolactin in ovarian follicular fluid stimulates endothelial cell proliferation. PMID: 19672107

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Somatotropin/prolactin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*