Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),Partial

Code CSB-EP021173BO1
Product Type Recombinant Protein
Size US$2466
Uniprot No. P15781
Relevance Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVEADDLCQECENISRLLTKMAKEAIFQDSVRKFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQSHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDKLALPLLPGVPQAKPGPQTQDLSEQL
Research Area Cell Biology
Source E.coli
Gene Names SFTPB
Protein Names 6 kDa protein Pulmonary surfactant-associated proteolipid SPL(Phe)
Expression Region 23-187aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 23.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Subcellular Location Secreted, extracellular space, surface film
Database Links

KEGG: bta:507398

STRING: 9913.ENSBTAP00000042549

UniGene: Bt.42696

Related Products

SFTPB Antibodies

SFTPB Antibodies for Bos taurus (Bovine)

SFTPB Proteins

SFTPB Proteins for Bos taurus (Bovine)

SFTPB ELISA Kit

SFTPB ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.