Recombinant Bovine Pulmonary surfactant-associated protein B(SFTPB),Partial

Code CSB-EP021173BO1
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names SFTPB
Uniprot No. P15781
Research Area Cell Biology
Alternative Names SFTPB; SFTP3; Pulmonary surfactant-associated protein B; SP-B; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe)
Species Bos taurus (Bovine)
Source E.coli
Expression Region 23-187aa
Target Protein Sequence AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVEADDLCQECENISRLLTKMAKEAIFQDSVRKFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQSHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDKLALPLLPGVPQAKPGPQTQDLSEQL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 23.5kDa
Protein Length Partial
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Gene References into Functions
  1. Measurements of the depth of SP-B(CTERM) indicated the peptide center positions ~8A more deeply than the phosphate headgroups, a topology that may allow the peptide to promote functional lipid structures without causing micellization upon compression. PMID: 22252270
  2. results suggest the hydrophobic surfactant protein, SP-B, protects alveolar surfactant phospholiopids from hydrolysis mediated by multiple sPLA(2) in both vesicles (alveolar subphase) and monomolecular films (air-liquid interface) PMID: 22037357
  3. The hydrophobic surfactant proteins SP-B and SP-C induce formation of bicontinuous inverse cubic phases. PMID: 20409474
  4. Reactive oxygen species inactivation of lipid extract surfactant B (SP-B) biophysical activity appears to involve modification of a maximum of three amino acids: Trp9, Met29, and Met65. PMID: 17425286
Subcellular Location Secreted, extracellular space, surface film
Database Links

KEGG: bta:507398

STRING: 9913.ENSBTAP00000042549

UniGene: Bt.42696

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1