Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

Code CSB-YP004966BO
Product Type Recombinant Protein
Size US$2959
Uniprot No. P31783
Relevance Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD_antigen: CD8a
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN
Research Area Immunology
Source Yeast
Gene Names CD8A
Protein Names Recommended name: T-cell surface glycoprotein CD8 alpha chain Alternative name(s): CD_antigen= CD8a
Expression Region 26-189aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule
Subcellular Location Cell membrane, Single-pass type I membrane protein
Database Links

KEGG: bta:281060

STRING: 9913.ENSBTAP00000028175

UniGene: Bt.50

Pathway Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway

Related Products

CD8A Antibodies

CD8A Antibodies for Bos taurus (Bovine)

CD8A Proteins

CD8A Proteins for Bos taurus (Bovine)

CD8A ELISA Kit

CD8A ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.