Tel : 301-363-4651
All
  • All
  • Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Raw Material For IVD Kit

EGFR｜BCMA｜CD44｜TROP2｜PD-L1｜CD22｜CD46｜CD276｜Exosome Isolation Kits

SARS-CoV-2: Nucleoprotein｜Spike protein｜N Antibody｜S Antibody｜ACE2｜CD147

Recombinant Bovine coronavirus Nucleoprotein(N)

Code CSB-EP320768BJK
Size US$2466
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names N
Uniprot No. P10527
Research Area Signal Transduction
Alternative Names N; 7a; Nucleoprotein; Nucleocapsid protein; NC; Protein N
Species Bovine coronavirus(strain Mebus)(BCoV)(BCV)
Source E.coli
Expression Region 1-448aa
Target Protein Sequence MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 55.3 kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs		 Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Related Products

N Proteins

Target Data

Function Major structural component of virions that associates with genomic RNA to form a long, flexible, helical nucleocapsid. Interaction with the M protein leads to the formation of virus particles. Binds to cellular membranes and phospholipids. Elicits cell-mediated immunity. May play roles in viral transcription and translation, and/or replication.
Subcellular Location Virion, Host cytoplasm, host perinuclear region, Host endoplasmic reticulum-Golgi intermediate compartment, Host Golgi apparatus, Host nucleus, host nucleolus
Protein Families Betacoronavirus nucleocapsid protein family

Most popular with customers

Promotions
Contact Us

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
The Overview of Gastric Cancer SWISS-PROT: When and How to Use It Information You Must Know about KCNN4 The True Face of Tumor Suppressor Gene p53 Two Types of Macrophages: M1 and M2 Macrophages EGFR and Its Application in Cancer Therapy Dual Role of TNFRSF14 in Immunology Learn to Distinguish Moles from Melanomas CD31- A Complex Function Molecule CD14-- A Membrane Receptor for Bacterial Lipopolysaccharides These Surface Markers Help You Identify Lymphocytes How Do You Get Exosomes? Cell Differentiation Determines the Fate of Cells CAR-T Cell Therapy- An Useful Treatment To Cancer CD19-The Most Popular Target with CAR T-Cell Therapy A Resume for Transmembrane Proteins Ovarian Cancer -- The Silent Killer G protein-Coupled Receptor - Targets for Drug Therapy Differentiation of Th17 Cells Tag Antibodies, Your Good Partner in Protein Research How to Choose the Loading Control Antibodies? Knowledge about Transthyretin Homeobox Transcription Factor- NANOG How to Inquire and Utilize the Signal Pathway on KEGG Costimulatory/Coinhibitory: Is B7-H3 An Enemy or A Friend? The Overview of Fc Receptors- Classification, Related Signaling Pathways and Application Effects of FSHR on Fertility and Tumors The Overview of Recombinant Antibody Chemokine Receptors – One Kind of Powerful Seven Transmembrane Spanning G Protein-coupled Receptor How to Choose the Right Secondary Antibody? A transport machine -- ATP-binding cassette Glial Fibrillary Acidic Protein - Astrocyte Specific Marker Surface Markers of Mesenchymal Stem Cells Oct4 -- The Gatekeeper of Pluripotency of Embryonic Stem Cells Understanding Hepatitis, Fighting Hepatitis Biological Activity of Proteins Stem Cell-What a Miraculous Resource in Human Body IL-6-Do You Really Know That? Growth Hormone - Not Only Promotes Height Increase The Rare Disease-Huntington's Disease CD147, a New Target of SARS-CoV-2 Invasion One World, One Hope——What Can We Do about AIDS? The Application of IHC in Pathological Diagnosis LPS/TLR4 Signal Transduction Pathway What You Have to Know about Cytokine Storm and Virus Infection Toll-like Receptors--The Eye of Innate Immunity Ice Bucket Challenge – Pay your attention to amyotrophic lateral sclerosis CD46, A Complement Regulator Human Leukocyte Antigen: Distinguish between Friend and Foe A "trembling" Parkinson's Disease What Are Immune Checkpoints? What Is Immune Checkpoint Therapy? What Are Immune Checkpoint Inhibitors? What Are Immune Checkpoint Proteins? Focus on Emerging Therapeutic Targets BCMA What Are Immune Checkpoint Pathways? Hematopoietic Stem Cell Surface Marker Tumor Necrosis Factor Receptor Superfamily and Apoptosis The Overview of Hippo Signaling Pathway What You Should Know The Common Sense of Neurodegeneration A Switch that Controls the Entry and Exit of Ions CD44- A Powerful Bridge Between Cells Tools You Need For Fundamental Research How do Th1 and Th2 Cells Differentiate? CD22- What A Powerful Co-receptor of B Cell Receptor What Powerful Model Organism Databases TCGA Database- A Good Partner of Researchers What a Powerful Artifact of DNA Compression - Histone Epigenetic Histone Modifications Pathway How Does Histone Modification Affect Gene Expression? How to Measure Histone Modification? Histone modification and Cancer Four Common Histone Modifications Identify Treg Cells. You Can Do This. About Thyroid Tumor, This Information You Must Know! What A Paradoxical TNF Signaling Pathway-Based on Different Receptors Don't Let Hepatocellular Carcinoma What Are the Effects of Abnormalities in the ALK Gene These Tumor Databases You Have To Know CD146, A Powerful Tumor Marker Introduction of Hepatocellular Carcinoma Related Signaling Pathways Mesothelin: A Rising Star of Cancer Immunotherapy ACE2, The Hottest Target of SARS-CoV-2 Invasion PD-1-- An Important Immune Checkpoint Does TNF Superfamily Inhibit Cancer or Promote Its Development? TROP2-An Important Target for Cancer Treatment MOA1-A Potential Cancer Therapy Target CD Antigens - From Leucocytes Surface Markers to Diagnostic Markers for Cancer Latest Changes in Journal Impact Factor Surface Markers of Natural Killer Cells What Is an Antibody? Applications of recombinant proteins How to choose a suitable expression vector? How to express a protein with bioactivity? 11 tips for choosing your right ELISA kit The Overview of Chemokine General Information of Different Tags CUSABIO's Five Expression Systems The Nature of Detergent and Its Application in Membrane Proteins The Overview of Colony Stimulating Factors Do You Really Know Neurons and Glia Cells in Nerve System? Apoptosis mediated by mitochondria Apoptosis mediated by endoplasmic reticulum Apoptosis mediated by death receptor Aesthetic Appreciation of Apoptosis Signal Pathway The Application of Nanodiscs in Membrane Proteins PD-1/PD-L1, What a Powerful Immune Checkpoint EphA3-A Regulator of Cell Adhesion and Migration The Overview of Growth Factor Tumor Necrosis Factor (TNF) The Overview of Interferon Tumor markers The Overview of Interleukin The Overview of Organelles The Overview of Autophagy Four Types of ELISA How to Choose an Antibody for Scientific Research? Production of Recombinant Protein The Overview of Phage Display：Protocol, Classification, Application and FAQs Crosstalk Between Autophagy and Apoptosis The Overview of Breast Cancer: Related Signaling Pathways, Therapeutic Targets The overview of Wnt signaling pathway The overview of TGF-β signaling pathway The Encyclopedia of Common Virus PI3K-Akt Signaling Pathway and Cancer Double-Edged Sword: TGF-β Do You Really Know TGF-β Superfamily? What You Have to Know about Exosomes CUSABIO's Five Expression Systems General Information of Different Tags How to express a protein with bioactivity? How to choose a suitable expression vector? Applications of recombinant proteins Production of Recombinant Protein
+ Show More
- Show Less

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1