All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Peptide
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Peptide

Recombinant Bovine coronavirus Nucleoprotein (N)

In Stock
Code CSB-EP320768BJK
Abbreviation Recombinant Bovine coronavirus N protein
MSDS
MSDS Datasheet
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
P10527
Research Area
Signal Transduction
Alternative Names
N; 7a; Nucleoprotein; Nucleocapsid protein; NC; Protein N
Species
Bovine coronavirus (strain Mebus) (BCoV)(BCV)
Source
E.coli
Expression Region
1-448aa
Target Protein Sequence
MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Protein FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Intact bovine coronavirus (BCoV) nucleoprotein(N) cDNA (1-448AA) with an N-terminal 6xHis-tag was expressed in E.coli. The product is the recombinant full-length BCoV-N protein. The purity of this protein is greater than 85% determined by SDS-PAGE. Its predicted molecular weight is about 55.3 kDa. In addition to producing specific antibodies, this recombinant BCoV-N protein may be used in signal transduction studies.

Related Products

N Antibodies

N Proteins

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Betacoronavirus nucleocapsid protein family
Promotions
Reward For Reviews
Free antibody trial
Contact Us

  Email: [email protected]
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
TWIK2 channel mediates inflammation, study finds Neutralizing Antibody Stands Out Among Antiviral Therapies SWISS-PROT: When and How to Use It Osteoprotegerin (OPG): What is Its Potential as a Biomarker or Therapeutic Target? Protein Acetylation: An Important Post-translational Modification in Eukaryotic Cells Oncogenes and Cancer Neuronal Markers and Neurodegenerative Diseases GPC3: The Next-Promising Target in Cancer Immunotherapy Claudin 18.2, is a 'Dark Horse' in Anti-tumour Therapy? What Are Histones: Unraveling Their Critical Roles in Disease Pathogenesis Does Antibody-dependent Enhancement Occur in SARS-CoV-2 Infection? Decoding the Biological Complexity of Endometrial Cancer: Essential Insights for Researchers Melanoma, the Most Serious Type of Skin Cancer Multiple Myeloma, One of High-Risk Factors for COVID-19 Non-Hodgkin's Lymphoma, One of Common Heterogeneous Malignant Tumors Information You Must Know about KCNN4 STAT3: a Key Transcriptional Regulator in Cancer Streptococcus pneumoniae, a Primary Cause of Pneumonia The True Face of Tumor Suppressor Gene p53 MUC16 (CA125): a Promising Predictive Marker and Therapeutic Target in Cancer Two Types of Macrophages: M1 and M2 Macrophages EGFR and Its Application in Cancer Therapy An Overview of Cell Death: Necrosis and Apoptosis The Overview of One Category of Important Cell Receptors: Receptor Tyrosine Kinases TNFRSF9: A Potent Immune-Stimulator in Cancer Cross-reactivity of Antibody: Beneficial or Harmful? GCGR: A Regulator of Energy Balance Holds a Potential in Treatment Diabetes TNFR1: A Multifaceted Molecule in Cancer, Another Promising Therapeutic Target for COVID-19 NRG1: an Intriguing Therapeutic Target in Diseases Approaches to Determinate Protein Concentration CCR8: a Specific Marker on Tregs Cells, the Next Promising Candidate for Antitumor Drugs! C5AR1: A Potential Molecule of Complement System to Fuel COVID-19 Therapy! Lysosomal Enzymes and Lysosomal Storage Disorders (LSDs) 2021 Insights on the CAR-T Cell Therapy: the Most Popular Targets for Solid Tumor! Cellular Senescence and Its Markers CD24: A Key Element in the EXO-CD24 Technique for Combating COVID-19 NKG2D, a Powerful Molecule Involved In CAR-T And Car-NK Cell Therapy How to Properly Reconstitute Lyophilized Proteins? DLL3: A New Molecular Target in Cancer Does LIF Only Play a Role in Leukaemia? How to Choose? Polyclonal, Monoclonal, or Recombinant Antibody? DNA Damage and Repair TFPI: a Natural Anticoagulant Protein, Future Therapies for Hemophilia Chemokine Receptor CCR4: the Key Role of CCR4+Treg Cells in Cancer Immunotherapy DT3C, a Powerful Tool for ADC Drug Internalization In Vitro Recombinant Monkeypox Virus Proteins - Accelerate Monkeypox Research Proteolysis Targeting Chimera (PROTAC): A "Revolutionary" Technology in Small Molecule Drug Discovery! CLDN6: A "New Favorite" in Targeted Cancer Therapy after CLDN 18.2! CLDN9: Another Key Regulator for Tumors or Hearing Loss from the CLDN Family! DDR1: a Novel Member of the RTKs Family, a Potential Target for Tumor Therapy! RSPO1: The key factor determining "battle of the sexes " is “favored” in the culture of organoids? How to Validate An Antibody？ TPBG/5T4: the Oncofetal Protein, an Appealing Target for ADC or Vaccine Therapeutics in Tumors! CD93, A Rising Star in Anti-Tumor Therapy A Review of A Human NGAL ELISA Kit Intestinal Mucosal Barrier Bodyguard --ALPi GPRC5D: Newly Efficient GPRC5D CAR-T or Bispecific Antibody Therapy to Fight Multiple Myeloma (MM) The Collection of Progress of Anti-GPCR Antibody Drugs Dual Role of TNFRSF14 in Immunology With the High Potential in Cancer Immunotherapy, CD40 Is Triggering Attention CD31- A Complex Function Molecule CD14, A Membrane Receptor for Bacterial Lipopolysaccharides Surface Markers That Help You Identify Lymphocytes ERBB3/HER3: a New Target for Tumor Therapy, a Driver Gene of Multi-Tumors How Do You Get Exosomes? Cell Differentiation Determines the Fate of Cells CD73, What a Powerful Therapy Target in Tumor Immune CAR-T Cell Therapy- An Useful Treatment To Cancer Exploring Biological Landscape of Cervical Cancer: A Comprehensive Overview for Researchers CLDN4: A Potential Prognostic Indicator and Therapeutic Target in Tumors！ What Are the Best Methods for Protein Purification? A Practical Guide CD19-The Most Popular Target with CAR T-Cell Therapy TFR1 (TFRC): a Stimulator of Fe Transport Affects Anemia, Neurodegenerative Disorders and Cancers! Immune Activation: Insights into T Cell Differentiation A Comprehensive Overview of Ovarian Cancer Categories over 10000! --Rare diseases that are no longer SLC7A11: a New Potential Therapeutic Target via Induced Ferroptosis in Tumors! Protein Phosphorylation: The Dynamic Language of Cellular Regulation Tuberculosis--A Resurgent Differentiation of Th17 Cells A Review of WFDC8 Antibody Tag Antibodies, Your Good Partner in Protein Research ULBP1: a Potent Member of NKG2D Ligands in CAR-T Therapy for Multiple Hematological and Solid Tumors! How to Choose the Loading Control Antibodies? GFRAL: A Promising Metabolic Target for Improving Obesity and Anorexia/Cachexia Microglial Markers: Insights into Microglial Activation and Function Knowledge about Transthyretin Homeobox Transcription Factor- NANOG How to Inquire and Utilize the Signal Pathway on KEGG Costimulatory/Coinhibitory: Is B7-H3 An Enemy or A Friend? The Overview of Fc Receptors- Classification, Related Signaling Pathways and Application Effects of FSHR on Fertility and Tumors The Overview of Recombinant Antibody DSG2: a Vital Member of Desmosomal Cadherin Family, an Exciting New Target for Cardiomyopathy, Adenovirus, and Tumors! How to Choose the Right Secondary Antibody? Glial Fibrillary Acidic Protein - Astrocyte Specific Marker MYL9: a New Member of Myosin Motors, a Key Driver of Cancer Cell Dynamic Regulation? ZG16B: A New Tumor Biomarker Offers Important Insights for Drug Development in Pancreatic Cancer! New Mechanism, NRP1 Enhances the Ability of SARS-CoV-2 Infection Surface Markers of Mesenchymal Stem Cells Anti-Payload Antibody DXD: A Highly Potent Tool for ADCs Pharmacokinetic (PK) Analysis! Oct4 -- The Gatekeeper of Pluripotency of Embryonic Stem Cells Interleukin 4 receptor (IL-4R/IL-4Ra): a Multifunctional Target of Cytokines, Suggesting Diverse Potential in Asthma, Rhinitis, Viral, and Tumor Research! Leukemia, Why is it So Common? CEACAM8: a Member of CEA Family, Emerging as a Vital Player in Gynaecological or Gastrointestinal Cancer Research! Biological Activity of Proteins The Overview of Cell Viability Bladder Cancer: Insights into Molecular Biology,Signaling Pathways, and Biomarkers The Metabolic Phenotype of Tumor-Associated Macrophages in the Tumor Microenvironment Stem Cell-What a Miraculous Resource in Human Body IL-6-Do You Really Know That? Growth Hormone - Not Only Promotes Height Increase CEACAM5: A Promising Member of CEACAM Family, A Potential Target for ADC Drug Research! Nanobody, what a Powerful Novel Antibody! What Do You Need to Know Before Researching Human Metapneumovirus? CD147, a New Target of SARS-CoV-2 Invasion DKK1: a Well-Characterized Wnt Inhibitor, a Multifunctional Regulator in Multiple Cancers! One World, One Hope——What Can We Do about AIDS? The Application of IHC in Pathological Diagnosis LPS/TLR4 Signal Transduction Pathway What You Have to Know about Cytokine Storm and Virus Infection Toll-like Receptors--The Eye of Innate Immunity The difference between primary antibody and secondary antibody A Comprehensive Exploration into Amyotrophic Lateral Sclerosis CD46, A Complement Regulator ACVRL1 (Alk1): a Member of the TGF-β Receptor Family, a Novel Target for Anti-Angiogenic Drug Research! Do you Often Trouble in These Problems of ELISA? The Meaning of Irregular Antibody Screening What Factors Could Affect ELISA Results? CD47, A New Target for Tumor Immune A "trembling" Parkinson's Disease What Are Immune Checkpoints? What Is Immune Checkpoint Therapy? What Are Immune Checkpoint Inhibitors? What Are Immune Checkpoint Proteins? Focus on Emerging Therapeutic Targets BCMA What Are Immune Checkpoint Pathways? Hematopoietic Stem Cell Surface Marker CD20 Monoclonal Antibodies Drugs: There is an Explosion of New mAbs Against CD20! Tumor Necrosis Factor Receptor Superfamily and Apoptosis The Overview of Coagulation The Power and Promise of Stable Cell Lines Understanding of Serum Albumin VSIG4: a Prominent B7 Family Costimulatory Molecule or Complement Receptor in Cancers and Inflammatory Diseases! Monoclonal Antibody Drugs Overview SLC39A6/ZIP6: a Key Member of Zinc Transporters, a Novel Targeting Antigen of ADC! What You Have To Know about Lung Cancer TMEFF2: a Tumor-Specific Methylated Biomarker, a Novel Target in Multiple Cancers Protein Kinases Overview: Definition, Types, Function, Activation Mechanism, etc. The Overview of Hippo Signaling Pathway Exploring Neurodegeneration: A Comprehensive Guide for Researchers The Recently Emerged New Swine Influenza Virus -- G4 EA-H1N1 CD44- A Powerful Bridge Between Cells Tools You Need For Fundamental Research How do Th1 and Th2 Cells Differentiate? CD22- What A Powerful Co-receptor of B Cell Receptor What Powerful Model Organism Databases Protein Tyrosine Kinases: Anti-tumor Targets to be Explored Urgently TCGA Database- A Good Partner of Researchers GIPR: the Crucial Regulator of Glucose and Lipid Metabolism in Diabetes and Obesity! What a Powerful Artifact of DNA Compression - Histone Epigenetic Histone Modifications Pathway How Does Histone Modification Affect Gene Expression? How to Measure Histone Modification? Histone modification and Cancer Unraveling the Dynamic World of Histone Modifications: Implications in Gene Regulation and Disease Pathogenesis CD48: An Emerging Human Immune Co-stimulatory Molecule, Friend or Foe? Identify Treg Cells. You Can Do This. The Multifunctional Enzyme CD38: A Target for Immunotherapeutic Approaches in Cancer About Thyroid Tumor, This Information You Must Know! What A Paradoxical TNF Signaling Pathway-Based on Different Receptors What Essential Biological Knowledge is Needed for Hepatocellular Carcinoma Research? What Are the Effects of Abnormalities in the ALK Gene These Tumor Databases You Have To Know CD146, A Powerful Tumor Marker ELISA vs. Multiplex Immunoassays: Why ELISA Remains the Gold Standard among Immunoassays GPCR Drugs Discovery Introduction of Hepatocellular Carcinoma Related Signaling Pathways SIGIRR: A Novel Member of the TIR Superfamily Acts as the Anti-Inflammatory 'Brake' to Control Immune Response in Various Diseases! Mesothelin: A Rising Star of Cancer Immunotherapy CD70 (CD27L/TNFSF7): a TNF Receptor Member, a “Star” Target for Clinical Research in Systemic Lupus Erythematosus (SLE), Arthritis, and Tumors! Diabetes: What You Need to Know Before Starting Research? ACE2, The Hottest Target of SARS-CoV-2 Invasion PD-1-- An Important Immune Checkpoint Epitope Tags Overview Tetraspanin CD81: a Key Receptor for Hepatitis C Virus (HCV), an Established Exosome Marker, a Promising Target for Antiviral or Antitumor Research! CRTAM: Class I Restricted T cell-associated Molecule, an Intriguing New Member of the Ig-SF Family! Does TNF Superfamily Inhibit Cancer or Promote Its Development? TMPRSS2, an Activator for SARS-CoV-2 Invasion An Overview of CD226 and Its Promising Role in Cancer Immunotherapy TROP2, An Important Target for Cancer Research OMA1-A Potential Cancer Therapy Target CD Antigens - From Leucocytes Surface Markers to Diagnostic Markers for Cancer GLP-1R: An Energy Metabolism Regulator of GPCR Family, an Effective Drug Target for Type 2 Diabetes Therapy! TASIN represents a promising approach for prevention of colorectal cancer Latest Changes in Journal Impact Factor TM4SF1: a Member of the Transmembrane-4-Superfamily (L6), a New Vascular Therapeutic Target? Surface Markers of Natural Killer Cells What Is an Antibody? LY6G6D (LY6-G): A New Member of Lymphocyte Antigen-6 Family Holds Big Opportunities in Bispecific Antibody for CRC Treatment! Exploring the Science of Influenza A Virus: What You Need to Know Mucin-17/MUC17: An Unexpected Target for Tumor Immune Therapy, Notably Gastric Cancer! Applications of recombinant proteins ANGPT2 (Ang-2): the First Bispecific Antibody for Eye Vision Loss Therapy, a Novel Target for Tumor Angiogenesis! How to choose a suitable expression vector? How to express a protein with bioactivity? 11 tips for choosing your right ELISA kit The Overview of Chemokine Norwalk Virus Analysis of Factors Influencing ELISA Detection IL-17A: A Major Cytokine of the IL-17 Family, a Key Inflammation Target in Skin Diseases, or Inflammation-Associated Cancers! Protein Tags: A Comprehensive Overview ALPG: a Germ Cell-Associated Alkaline Phosphatase (ALP), a Highly Specific Cell Surface Antigen in Cancers! CUSABIO's Five Expression Systems Serotransferrin/TF: a Major Transferrin in Plasma, a Novel TF-Modified Nanoparticle for Tumor-Targeting Research! Myosin Regulatory Light Chains (MYL12A and MYL12B): the New Functional Ligands for CD69, Potential Targets for Cardiac Disease or Tumors Research? FAP may be a drug target for pancreatic cancer The Overview of Colony Stimulating Factors Do You Really Know Neurons and Glia Cells in Nerve System? Apoptosis mediated by mitochondria Apoptosis mediated by endoplasmic reticulum Apoptosis mediated by death receptor Inhibition of ASCT2 combats cancer in vitro and in vivo Aesthetic Appreciation of Apoptosis Signal Pathway Nanoparticle platform Get An Overview of His-Tag CD69: a Classical Early Marker of Lymphocyte Activation, a Pivotal Regulator of Hematologic Diseases and Autoimmune Disorders! PD-1/PD-L1, What a Powerful Immune Checkpoint EphA3-A Regulator of Cell Adhesion and Migration Cadherin-17 (CDH17): A Viable Target in Bispecific Antibodies or CAR-T Therapy to Fight Many Gastrointestinal Cancers! Itaconate is a negative regulator of inflammation The Memory thief - Alzheimer's disease The Overview of Growth Factor Tumor Necrosis Factor (TNF) The Overview of Interferon Tumor markers The Oncogene HER2: a New Target for Drug-Resistant Tumors A Group of Promising Proteins - Cell Cycle Markers The Overview of Interleukin The Overview of Organelles The Overview of Autophagy Four Types of ELISA How to Choose an Antibody for Scientific Research? Production of Recombinant Protein The Overview of Phage Display: Protocol, Classification, Application and FAQs Crosstalk Between Autophagy and Apoptosis TTR: an Important Protein of Amyloidosis, Novel Therapies are Upcoming for Rare Diseases ATTR-CM and ATTR-PN! The Overview of Breast Cancer: Related Signaling Pathways, Therapeutic Targets CDCP1: A Key Mediator for Cell Signaling in Cancers, an Emerging Target for Anti-Tumor Drugs! The overview of Wnt signaling pathway The overview of TGF-β signaling pathway The Encyclopedia of Common Virus PI3K-Akt Signaling Pathway and Cancer Double-Edged Sword: TGF-β Do You Really Know TGF-β Superfamily? CCR9: A Member of the Chemokine Receptor Family, an Emerging Target for Numerous Tumor Researches! Chemokine Receptor CCR6: the Specific Receptor for CCL20, a Potential Target for Drug Research in Inflammatory Diseases and Gastrointestinal Cancer! CEACAM6: a Potent CEA Family Molecule, a New Tumor Marker or Anti-Cancer Target! What Is Tomato Mosaic Virus IL2RA (CD25): A Specific Marker of Tregs Functions as Both Immune Modulators and Targeted Agents in Various Diseases! What Should You Know about Exosomes? Bispecific Antibody Overview: From Definition to Application The Review of Post-translational Modifications IGFL1: A Novel Secretory Protein of IGF-Like Family Presents a High Cancer-Promoting Potential! CXCR4: An Attractive Target of GPCR family Brings Promising New Drugs for Cancer Therapy！ CLDN3: Another Tight Junction Protein or New Drug Target, Interest in CLDN Family is Growing Fast! PROM1 (CD133): A New Cell Surface Marker of Cancer Stem Cells (CSCs), A More Significant Target for Immunotherapy! BDCA2/CLEC4C: a Novel Plasma Cell-Like Dendritic Cell (pDC) Marker and Potent Inhibitor of IFN-I that Blocks SLE Development! ENPP3 (CD203c): An Extracellular Enzyme, a Regulator for Nucleotide and Energy, an Indicator for Allergies, an Effective Target for RCC Therapy! ROR1, an Emerging Target for Tumor Immunotherapy GUCY2C: a Novel Target in Tumor Immunotherapy, Specially in Colorectal Cancer CAR T Therapy! SEMA4D/CD100: As an Important Immunoregulator to Improve Immunotherapy SSTR2: A Prominent Target in SSTR Family, Offers a More Precise Therapy in Neuroendocrine Tumors (NET) CADM1: an Immunoglobulin Superfamily Molecule, a New Tumor Suppressor Gene! Oncostatin M (OSM): A Member of IL-6 Cytokine Family, An Underestimated Player in Future Targeted Therapies? CNR1 (CB1): A Crucial Receptor of Endocannabinoid System Offers Potential Treatments for Tumors and Glycolipid Metabolism Disorders! DSG3: An Emerging Tumor-Associated Adhesion Factor, a Specific Marker for the Clinical Diagnosis of Pemphigus Vulgaris (PV)! MAGEA4: a Member of the Melanoma-Associated Antigen (MAGE) Family, a Popular Target for Tumor-Specific Immune Research! Targeting LRRC15: From tumor microenvironment regulation to fibrotic/infectious disease therapy In Vivo vs. In Vitro: Choosing the Right Experimental Model for Your Research Dipeptidase 3 (DPEP3): an Emerging Member of the DPEP Family, a Potential Therapeutic Target in Male Fertility or Tumor Research! Exploring Protein-Protein Interactions: A Comprehensive Guide to Understanding and Utilizing It IL-6: an Important Participant in the Inflammatory Cascade, One of the Most Functional Cytokines in Various Diseases Research! CT83/KK-LC-1: a Promising Therapeutic Target of CTAs Family, Currently in Clinical Research for Breast, Lung, Gastric Cancers, and Beyond! What Are the Best Antibody Purification Methods for Your Research Needs? What is Myc Tag: Definition, Function, Applications & Comparison with Other Epitope Tags What Is Protein Characterization: Definition, Examples, Methods, and Techniques What is a His Tag? A Guide from Definition to Applications New Power in the Fight Against Cancer: Spotlight on Rising Stars of ADC Drugs at the 2024 ASCO Annual Meeting Nectin-4: a Key Target in the IgSF Family, Boosting Clinical Drug Research in Various Tumors! T Cell Activation - The Switch for T Cell Executive Function Verified vs. Unverified Recombinant Proteins: Making the Right Choice for Your Research How to Choose Monoclonal Antibody Technology? A Definitive Guide Advancements in CDH6-Targeted Drug Research for Cancer Treatment What Bacterial Antigens Are Used in Vaccines? Glycolysis Pathway: The Essential Energy Source for Cells, Even in Low-Oxygen Conditions What Is Compartment Modelling in Pharmacokinetics? ACVR2A and ACVR2B as Key Targets for Muscle Growth, Weight Loss, PHA in Drug Research！ A Comprehensive Guide to Monoclonal Antibody Production How do we dissolve BSA? TIGIT Targeted Immunotherapies Offer New Hope for Cancer Treatment TNFSF15/TL1A: The Rise of the Next Billion-Dollar Target as Pharma Giants Stake Their Claims Antigen Retrieval: Uncovering Antigen Masking to Improve Immunohistochemistry Results How to Choose An Appropriate Isotype Control Antibody? CD79A and CD79B: Key Targets in B Cell Signaling Pathways and Therapeutic Potential The Structure, Function, and Research Progress of Lymphotoxin β Receptor (LTBR) in Disease and Drug Development CSF2/GM-CSF: A Key Molecule in Immune Regulation and Disease Treatment TNFSF18: Unlocking New Frontiers in Cancer Immunotherapy How AI is Reshaping Biological Research? A Comprehensive Guide to Tools and Practical Strategies IL-6: A Central Factor in Cytokine Storms and a Health Alert for Infections and Diseases How to Choose the Right Recombinant Protein for Your Experimental Model? TNFRSF13C (BAFF-R): A Key Target for Immune Regulation and Disease Treatment PVR (CD155): A Key Factor in Tumor Immune Evasion and a Novel Therapeutic Target How the Tumor Microenvironment Fuels Cancer's Deadly Evolution MSTN: A Key Target for Targeted Therapy in Muscle Diseases​ Decoding Recombinant Protein Expression: Strategic Solutions & Practical Insights CEACAM1: An Emerging Multifunctional Target for Cancer-Immune Modulation DLL4: A Key Target for Angiogenesis Regulation EDNRA: A Key Target for Disease-Associated Angioplasty, Tumor Invasion, and Metabolic Regulation Pioneering CAR-T Cell Therapy: Advancing Personalized Cancer Treatment How Do CTLA-4 Inhibitors Work? A Complete Guide for Early-Career Researchers Interleukin-2 (IL2): The "Double-Edged Sword" of the Immune System CCL17: A Chemokine with Multiple Biological Functions Immune Battlefield's "Scout": Decoding the NCR3 Target PTH1R: Key Therapeutic Target in Bone & Metabolic Health | CUSABIO Colony Stimulating Factor 1 (CSF1): Its Key Role in Diseases and New Progress in Targeted Therapy B7-H6: A Key Ligand of NK Cell Immune Checkpoints Reshaping the Landscape of Tumor Immunotherapy MICB: a key molecule that bridges cellular stress and immune responses MICA: key regulatory molecule for tumor immune surveillance and its therapeutic target potential LYPD3: An Emerging Star in Solid Tumor Therapy TSLP: A Key Target in Allergic and Inflammatory Diseases LAG3: The Next Frontier in Tumor Immunotherapy Parathyroid Hormone (PTH): A Key Target for Regulating Calcium-Phosphate Metabolism and Skeletal Health Targeting the "Hidden Target" ROR1: A Breakthrough for Broad-Spectrum Cancer Therapy? SEZ6: A New Therapeutic Target for Neuroendocrine Tumors with Multiple ADCs in Clinical Development CUSABIO's Five Expression Systems General Information of Different Tags How to express a protein with bioactivity? How to choose a suitable expression vector? Applications of recombinant proteins Production of Recombinant Protein
Related pathways
Virus Infection
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of email
Email
[email protected]
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Privacy Policy
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*