Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP320768BJK |
| Size | US$2466 |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | N |
| Uniprot No. | P10527 |
| Research Area | Signal Transduction |
| Alternative Names | N; 7a; Nucleoprotein; Nucleocapsid protein; NC; Protein N |
| Species | Bovine coronavirus(strain Mebus)(BCoV)(BCV) |
| Source | E.coli |
| Expression Region | 1-448aa |
| Target Protein Sequence | MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 55.3 kDa |
| Protein Length | Full Length |
| Tag Info | N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
| Function | Major structural component of virions that associates with genomic RNA to form a long, flexible, helical nucleocapsid. Interaction with the M protein leads to the formation of virus particles. Binds to cellular membranes and phospholipids. Elicits cell-mediated immunity. May play roles in viral transcription and translation, and/or replication. |
| Subcellular Location | Virion, Host cytoplasm, host perinuclear region, Host endoplasmic reticulum-Golgi intermediate compartment, Host Golgi apparatus, Host nucleus, host nucleolus |
| Protein Families | Betacoronavirus nucleocapsid protein family |
Recombinant Human interleukin-16 proein(IL16) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Interleukin-1 alpha protein(IL1A) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Interleukin-1 receptor antagonist protein(IL1RN) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Interleukin-2 protein(IL2) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Interleukin-4 protein(IL4) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Interleukin-5 protein(IL5) (Active)
Express system: E.Coli
Species: Homo sapiens (Human)
Recombinant Human Interleukin-10 protein(IL10) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Interleukin-19 protein(IL19) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide
