Tel : 301-363-4651
All
  • All
  • Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Raw Material For IVD Kit

CLDN18.2｜CD20｜Proteinase K｜EGFR｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits

SARS-CoV-2: Nucleoprotein｜Spike protein｜S (RBD) protein｜N Antibody｜S Antibody｜Neutralizing Ab ELISA Kit

Recombinant Bovine coronavirus Nucleoprotein(N)

In Stock
Code CSB-EP320768BJK
Size $2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

Intact bovine coronavirus (BCoV) nucleoprotein(N) cDNA (1-448AA) with an N-terminal 6xHis-tag was expressed in E.coli. The product is the recombinant full-length BCoV-N protein. The purity of this protein is greater than 85% determined by SDS-PAGE. Its predicted molecular weight is about 55.3 kDa. In addition to producing specific antibodies, this recombinant BCoV-N protein may be used in signal transduction studies.
Purity Greater than 85% as determined by SDS-PAGE.
Target Names N
Uniprot No. P10527
Research Area Signal Transduction
Alternative Names N; 7a; Nucleoprotein; Nucleocapsid protein; NC; Protein N
Species Bovine coronavirus (strain Mebus) (BCoV)(BCV)
Source E.coli
Expression Region 1-448aa
Target Protein Sequence MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 55.3 kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer，50% glycerol
Troubleshooting
and FAQs		 Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Related Products

N antibodies

N Proteins

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)		 Major structural component of virions that associates with genomic RNA to form a long, flexible, helical nucleocapsid. Interaction with the M protein leads to the formation of virus particles. Binds to cellular membranes and phospholipids. Elicits cell-mediated immunity. May play roles in viral transcription and translation, and/or replication.
Subcellular Location Virion, Host cytoplasm, host perinuclear region, Host endoplasmic reticulum-Golgi intermediate compartment, Host Golgi apparatus, Host nucleus, host nucleolus
Protein Families Betacoronavirus nucleocapsid protein family
Promotions
Contact Us

  Tel: 301-363-4651
  Email: [email protected]m
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
TWIK2 channel mediates inflammation, study finds The Overview of Gastric Cancer Neutralizing Antibody Stands Out Among Antiviral Therapies SWISS-PROT: When and How to Use It Osteoprotegerin (OPG): What is Its Potential as a Biomarker or Therapeutic Target? Protein Acetylation: An Important Post-translational Modification in Eukaryotic Cells Oncogenes and Cancer Neuronal Markers and Neurodegenerative Diseases GPC3: The Next-Promising Target in Cancer Immunotherapy Claudin 18.2, is a 'Dark Horse' in Anti-tumour Therapy? Histones and Their Roles in Diseases Does Antibody-dependent Enhancement Occur in SARS-CoV-2 Infection? Endometrial Cancer, a Female Killer That is Easily Ignored Melanoma, the Most Serious Type of Skin Cancer Multiple Myeloma, One of High-Risk Factors for COVID-19 Non-Hodgkin's Lymphoma, One of Common Heterogeneous Malignant Tumors Information You Must Know about KCNN4 STAT3: a Key Transcriptional Regulator in Cancer Streptococcus pneumoniae, a Primary Cause of Pneumonia The True Face of Tumor Suppressor Gene p53 MUC16 (CA125): a Promising Predictive Marker and Therapeutic Target in Cancer Two Types of Macrophages: M1 and M2 Macrophages EGFR and Its Application in Cancer Therapy An Overview of Cell Death: Necrosis and Apoptosis The Overview of One Category of Important Cell Receptors: Receptor Tyrosine Kinases TNFRSF9: A Potent Immune-Stimulator in Cancer Cross-reactivity of Antibody: Beneficial or Harmful? TNFR1: A Multifaceted Molecule in Cancer, Another Promising Therapeutic Target for COVID-19 NRG1: an Intriguing Therapeutic Target in Diseases NKG2D, a Powerful Molecule Involved In CAR-T And Car-NK Cell Therapy DLL3: A New Molecular Target in Cancer Does LIF Only Play a Role in Leukaemia? How to Choose? Polyclonal, Monoclonal, or Recombinant Antibody? CD20, Why is It Such Popular in Antibody Drug Development? DNA Damage and Repair Dual Role of TNFRSF14 in Immunology Learn to Distinguish Moles from Melanomas With the High Potential in Cancer Immunotherapy, CD40 Is Triggering Attention CD31- A Complex Function Molecule CD14-- A Membrane Receptor for Bacterial Lipopolysaccharides Surface Markers That Help You Identify Lymphocytes ERBB3/HER3: a New Target for Tumor Therapy, a Driver Gene of Multi-Tumors How Do You Get Exosomes? Cell Differentiation Determines the Fate of Cells CD73, What a Powerful Therapy Target in Tumor Immune CAR-T Cell Therapy- An Useful Treatment To Cancer Cervical Cancer, One of the Most Common Killers of Women CD19-The Most Popular Target with CAR T-Cell Therapy A Resume for Transmembrane Proteins Ovarian Cancer -- The Silent Killer G protein-Coupled Receptor - Targets for Drug Therapy Differentiation of Th17 Cells Tag Antibodies, Your Good Partner in Protein Research How to Choose the Loading Control Antibodies? Knowledge about Transthyretin Homeobox Transcription Factor- NANOG How to Inquire and Utilize the Signal Pathway on KEGG Costimulatory/Coinhibitory: Is B7-H3 An Enemy or A Friend? The Overview of Fc Receptors- Classification, Related Signaling Pathways and Application Effects of FSHR on Fertility and Tumors The Overview of Recombinant Antibody Chemokine Receptors – One Kind of Powerful Seven Transmembrane Spanning G Protein-coupled Receptor How to Choose the Right Secondary Antibody? A transport machine -- ATP-binding cassette Glial Fibrillary Acidic Protein - Astrocyte Specific Marker New Mechanism, NRP1 Enhances the Ability of SARS-CoV-2 Infection Surface Markers of Mesenchymal Stem Cells Oct4 -- The Gatekeeper of Pluripotency of Embryonic Stem Cells Understanding Hepatitis, Fighting Hepatitis Leukemia, Why is it So Common? Biological Activity of Proteins The Overview of Cell Viability Bladder Cancer, A Malignancy that Favors Men The Metabolic Phenotype of Tumor-Associated Macrophages in the Tumor Microenvironment Stem Cell-What a Miraculous Resource in Human Body IL-6-Do You Really Know That? Growth Hormone - Not Only Promotes Height Increase The Rare Disease-Huntington's Disease Nanobody, what a Powerful Novel Antibody! CD147, a New Target of SARS-CoV-2 Invasion One World, One Hope——What Can We Do about AIDS? The Application of IHC in Pathological Diagnosis LPS/TLR4 Signal Transduction Pathway What You Have to Know about Cytokine Storm and Virus Infection Toll-like Receptors--The Eye of Innate Immunity The difference between primary antibody and secondary antibody Ice Bucket Challenge – Pay your attention to amyotrophic lateral sclerosis CD46, A Complement Regulator Human Leukocyte Antigen: Distinguish between Friend and Foe Do you Often Trouble in These Problems of ELISA? The Meaning of Irregular Antibody Screening What Factors Could Affect ELISA Results? CD47, A New Target for Tumor Immune A "trembling" Parkinson's Disease What Are Immune Checkpoints? What Is Immune Checkpoint Therapy? What Are Immune Checkpoint Inhibitors? What Are Immune Checkpoint Proteins? Focus on Emerging Therapeutic Targets BCMA What Are Immune Checkpoint Pathways? Hematopoietic Stem Cell Surface Marker Tumor Necrosis Factor Receptor Superfamily and Apoptosis The Overview of Coagulation Understanding of Serum Albumin Kinase Classification The Overview of Hippo Signaling Pathway What You Should Know The Common Sense of Neurodegeneration A Switch that Controls the Entry and Exit of Ions The Recently Emerged New Swine Influenza Virus -- G4 EA-H1N1 CD44- A Powerful Bridge Between Cells Tools You Need For Fundamental Research How do Th1 and Th2 Cells Differentiate? CD22- What A Powerful Co-receptor of B Cell Receptor What Powerful Model Organism Databases TCGA Database- A Good Partner of Researchers What a Powerful Artifact of DNA Compression - Histone Epigenetic Histone Modifications Pathway How Does Histone Modification Affect Gene Expression? How to Measure Histone Modification? Histone modification and Cancer Four Common Histone Modifications CD48: An Emerging Human Immune Co-stimulatory Molecule, Friend or Foe? Identify Treg Cells. You Can Do This. The Multifunctional Enzyme CD38: A Target for Immunotherapeutic Approaches in Cancer About Thyroid Tumor, This Information You Must Know! What A Paradoxical TNF Signaling Pathway-Based on Different Receptors Don't Let Hepatocellular Carcinoma What Are the Effects of Abnormalities in the ALK Gene These Tumor Databases You Have To Know CD146, A Powerful Tumor Marker Introduction of Hepatocellular Carcinoma Related Signaling Pathways Mesothelin: A Rising Star of Cancer Immunotherapy Do You Really Know the Gonorrhea? Diabetes: What You Need to Know ACE2, The Hottest Target of SARS-CoV-2 Invasion PD-1-- An Important Immune Checkpoint Please Take It Seriously-Influenza Does TNF Superfamily Inhibit Cancer or Promote Its Development? TMPRSS2, an Activator for SARS-CoV-2 Invasion An Overview of CD226 and Its Promising Role in Cancer Immunotherapy TROP2-An Important Target for Cancer Treatment OMA1-A Potential Cancer Therapy Target CD Antigens - From Leucocytes Surface Markers to Diagnostic Markers for Cancer TASIN represents a promising approach for prevention of colorectal cancer Latest Changes in Journal Impact Factor Antibody ABTAA alters tumor blood vessels Surface Markers of Natural Killer Cells What Is an Antibody? Modified red blood cells prevents harmful immune response BMTP-11 found to delay progression of osteosarcoma Applications of recombinant proteins How to choose a suitable expression vector? How to express a protein with bioactivity? 11 tips for choosing your right ELISA kit The Overview of Chemokine Get an Overview of Protein Tags CUSABIO's Five Expression Systems Study provides clues to the role of PRMT5 in glioblastoma Lack of IL-33 contributes to Alzheimer's disease FAP may be a drug target for pancreatic cancer The Nature of Detergent and Its Application in Membrane Proteins A drug candidate holds promise in treating autism The Overview of Colony Stimulating Factors A TRPC5 inhibitor has therapeutic benefits for progressive kidney disease, study finds Do You Really Know Neurons and Glia Cells in Nerve System? Apoptosis mediated by mitochondria Apoptosis mediated by endoplasmic reticulum Apoptosis mediated by death receptor Inhibition of ASCT2 combats cancer in vitro and in vivo Aesthetic Appreciation of Apoptosis Signal Pathway The Application of Nanodiscs in Membrane Proteins PD-1/PD-L1, What a Powerful Immune Checkpoint EphA3-A Regulator of Cell Adhesion and Migration Itaconate is a negative regulator of inflammation The Memory thief - Alzheimer's disease The Overview of Growth Factor WAY-316606 will treat hair loss? Tumor Necrosis Factor (TNF) Role of non-coding RNA in prostate cancer progression The Overview of Interferon Tumor markers The Oncogene HER2: a New Target for Drug-Resistant Tumors A Group of Promising Proteins - Cell Cycle Markers The Overview of Interleukin The Overview of Organelles The Overview of Autophagy Four Types of ELISA How to Choose an Antibody for Scientific Research? Production of Recombinant Protein The Overview of Phage Display：Protocol, Classification, Application and FAQs Crosstalk Between Autophagy and Apoptosis The Overview of Breast Cancer: Related Signaling Pathways, Therapeutic Targets The overview of Wnt signaling pathway The overview of TGF-β signaling pathway The Encyclopedia of Common Virus PI3K-Akt Signaling Pathway and Cancer Double-Edged Sword: TGF-β Do You Really Know TGF-β Superfamily? What Is Tomato Mosaic Virus What You Have to Know about Exosomes CUSABIO's Five Expression Systems General Information of Different Tags How to express a protein with bioactivity? How to choose a suitable expression vector? Applications of recombinant proteins Production of Recombinant Protein
Related pathways
Virus Infection

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1