Recombinant Carcinoscorpius rotundicauda Limulus clotting factor C, partial

In Stock
Code CSB-EP638870CDQ
Abbreviation Recombinant Carcinoscorpius rotundicauda Limulus clotting factor C protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Limulus clotting factor C; FC; EC 3.4.21.84) [Cleaved into: Limulus clotting factor C heavy chain; Limulus clotting factor C light chain; Limulus clotting factor C chain A; Limulus clotting factor C chain B]
Species
Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda)
Source
E.coli
Expression Region
691-1019aa
Target Protein Sequence
SSQPSTVDLASKVKLPEGHYRVGSRAIYTCESRYYELLGSQGRRCDSNGNWSGRPASCIPVCGRSDSPRSPFIWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPNQFKMYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSETIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant Carcinoscorpius rotundicauda Limulus clotting factor C in E. coli starts with the co-insertion of the gene of interest (691-1019aa of Carcinoscorpius rotundicauda Limulus clotting factor C) into an expression vector with an N-terminal 6xHis-tag gene, followed by transformation into E. coli cells. These cells are grown under conditions that induce protein expression. After sufficient growth, cells are lysed to release the recombinant protein. Purification is carried out using the affinity chromatography technique. The purity of the protein is confirmed with SDS-PAGE, reaching up to 85%.

Carcinoscorpius rotundicauda Limulus clotting factor C, identified as a serine protease zymogen, plays a central role in initiating a cascade of pathways that lead to the coagulation of Gram-negative bacteria [1]. Studies have shown that factor C of Carcinoscorpius rotundicauda is both immunoreactive and functional, indicating its significance in the immune response of the horseshoe crab [2].

Factor C from Carcinoscorpius rotundicauda has been extensively studied for its ability to bind endotoxins and induce bacteriostasis, showcasing its importance in the defense mechanisms of the horseshoe crab [3]. The interaction of factor C with lipopolysaccharides (LPS) triggers a series of events leading to the activation of clotting enzymes and the subsequent clotting process, essential for encapsulating and eliminating bacteria [4].

References:
[1] M. Khan, T. Muthamilselvan, H. Kang, & I. Hwang, Plant produced endotoxin binding recombinant proteins effectively remove endotoxins from protein samples, Scientific Reports, vol. 12, no. 1, 2022. https://doi.org/10.1038/s41598-022-20776-6
[2] A. Pui, B. Ho, & J. Ding, Yeast recombinant factor c from horseshoe crab binds endotoxin and causes bacteriostasis, Journal of Endotoxin Research, vol. 4, no. 6, p. 391-400, 1997. https://doi.org/10.1177/096805199700400602
[3] J. Ding, C. Chai, A. Pui, & B. Ho, Expression of full length and deletion homologues of carcinoscorpius rotundicauda factor c in saccharomyces cerevisiae: immunoreactivity and endotoxin binding, Journal of Endotoxin Research, vol. 4, no. 1, p. 33-43, 1997. https://doi.org/10.1177/096805199700400105
[4] S. Srimal, T. Miyata, S. Kawabata, T. Miyata, & S. Iwanaga, The complete amino acid sequence of coagulogen isolated from southeast asian horseshoe crab, carcinoscorpius rotundicauda1, The Journal of Biochemistry, vol. 98, no. 2, p. 305-318, 1985. https://doi.org/10.1093/oxfordjournals.jbchem.a135283

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B.
Subcellular Location
Secreted. Note=Secreted in hemolymph.
Protein Families
Peptidase S1 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*