Recombinant Chicken Protein Wnt-11(WNT11)

Code CSB-YP026131CH
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP026131CH
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP026131CH-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP026131CH
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP026131CH
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names WNT11
Uniprot No. P49339
Alternative Names WNT11; WNT-11; Protein Wnt-11
Species Gallus gallus (Chicken)
Expression Region 25-354
Target Protein Sequence IKWIALSKTPSSLALNQTQHCKQLEGLVVSQVQLCRSNLELMQTIIQAAREVIKTCRKTF SDMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHTIARACTTGDLPGCSCGPIP GETPGPGYRWGGCADNLNYGLIMGSKFSDAPMKMKKSGSQANKLMHLHNSEVGRQVLKAS LEMKCKCHGVSGSCSIKTCWKGLQELRDIALDLKNKYLSATKVVHRPMGTRKYLVPKDID IRPVKETELIYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYMDK VVERCHCKYHWCCYVTCKKCERTVERYVCK
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand for members of the frizzled family of seven transmembrane receptors. May play a role in the formation of dermal structure, both limb and feather buds. Is likely to signal over only few cell diameters.
Gene References into Functions
  1. Wnt11 is required for dense dermis and subsequent cutaneous appendage formation, by influencing the cell fate decision of the cells in the dorsomedial lip. PMID: 24671096
  2. Wnt11 and Wnt6 act as factors maintaining the epithelial nature of the dorsomedial and ventrolateral lips of the dermomyotome, respectively, during dermomyotomal growth. PMID: 16818447
  3. during early chick myogenesis WNT11 has an essential role in the oriented elongation of the myocytes PMID: 18987628
Subcellular Location Secreted, extracellular space, extracellular matrix.
Protein Families Wnt family
Tissue Specificity Expressed in the dermatome. The expression domain is mutually exclusive to the other Wnt genes.
Database Links

KEGG: gga:395562

STRING: 9031.ENSGALP00000001229

UniGene: Gga.13827

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1