Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
NEU2; Sialidase-2; EC 3.2.1.18; Cytosolic sialidase; N-acetyl-alpha-neuraminidase 2
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Expression Region
1-379aa
Target Protein Sequence
MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene responsible for the Cricetulus griseus NEU2 protein (1-379aa) is cloned into a plasmid vector to obtain recombinant plasmid, which is then transformed into baculovirus cells. baculovirus cells demonstrating successful uptake of the recombinant plasmid are selected based on their ability to endure a specific antibiotic. The baculovirus cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. Post-expression, affinity purification is employed to isolate and purify the recombinant Cricetulus griseus NEU2 protein from the cell lysate. The resulting recombinant protein is subjected to denaturing SDS-PAGE, allowing for an estimation of its purity, surpassing 90%.
