Recombinant Chinese hamster Sialidase-2 (NEU2)

^{In Stock}

Code	CSB-BP734101DXU
Abbreviation	Recombinant Cricetulus griseus EEF1A1 protein
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NEU2

Uniprot No.

Q64393

Research Area

Metabolism

Alternative Names

NEU2; Sialidase-2; EC 3.2.1.18; Cytosolic sialidase; N-acetyl-alpha-neuraminidase 2

Species

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Source

Baculovirus

Expression Region

1-379aa

Target Protein Sequence

MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

45.8

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene responsible for the Cricetulus griseus NEU2 protein (1-379aa) is cloned into a plasmid vector to obtain recombinant plasmid, which is then transformed into baculovirus cells. baculovirus cells demonstrating successful uptake of the recombinant plasmid are selected based on their ability to endure a specific antibiotic. The baculovirus cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. Post-expression, affinity purification is employed to isolate and purify the recombinant Cricetulus griseus NEU2 protein from the cell lysate. The resulting recombinant protein is subjected to denaturing SDS-PAGE, allowing for an estimation of its purity, surpassing 90%.