Recombinant Cricetulus griseus Sialidase-2 (NEU2)

Code CSB-MP734101DXU
Product Type Recombinant Protein
Size US$1848
Uniprot No. Q64393
Abbreviation NEU2
Storage Buffer Tris-based buffer,50% glycerol
Species Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ
Research Area Metabolism
Source Mammalian cell
Gene Names NEU2
Protein Names Recommended name: Sialidase-2 EC= 3.2.1.18 Alternative name(s): Cytosolic sialidase N-acetyl-alpha-neuraminidase 2
Expression Region 1-379aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 47
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the removal of sialic acid (N-acetylneuraminic acid) moities from glycoproteins, oligosaccharides and gangliosides.
Subcellular Location Cytoplasm
Protein Families Glycosyl hydrolase 33 family
Database Links

KEGG: cge:100689301

Related Products

NEU2 Antibodies

NEU2 Antibodies for Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

NEU2 Proteins

NEU2 Proteins for Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.