Recombinant Clostridium botulinum Penicillin-binding protein 1A(pbpA),Partial

In Stock
Code CSB-EP401992CWV
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. A5I6G4
Lead Time 3-7 business days
Relevance Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Peptidoglycan TGase DD-transpeptidase
Species Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ
Research Area Cell Biology
Source E.coli
Gene Names pbpA
Expression Region 663-830aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 35.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Subcellular Location Cell membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 51 family; Transpeptidase family
Database Links

KEGG: cbh:CLC_2985

Related Products

pbpA Antibodies

pbpA Antibodies for Clostridium botulinum

pbpA Proteins

pbpA Proteins for Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.