Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
pbpA; CBO3083; CLC_2985; Penicillin-binding protein 1A; PBP1a) [Includes: Penicillin-insensitive transglycosylase; EC 2.4.1.129; Peptidoglycan TGase); Penicillin-sensitive transpeptidase; EC 3.4.16.4; DD-transpeptidase)]
Species
Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Expression Region
663-830aa
Target Protein Sequence
VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Clostridium botulinum pbpA was expressed with the amino acid range of 663-830. The expected molecular weight for the pbpA protein is calculated to be 35.2 kDa. Expression of this pbpA protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the pbpA encoding gene fragment was conducted, allowing for easier detection and purification of the pbpA protein in subsequent stages.
Clostridium botulinum Penicillin-binding protein 1A (pbpA) is a crucial component involved in cell wall synthesis and maintenance within the bacterium Clostridium botulinum. Its primary function is to catalyze the formation of peptide cross-links in the bacterial cell wall, imparting structural integrity. In microbiology and antibacterial drug development, pbpA is a focal point for understanding antibiotic resistance mechanisms and exploring novel therapeutic targets. Its research areas encompass elucidating its role in cell wall biosynthesis and investigating strategies to combat antibiotic resistance in Clostridium botulinum. PbpA's significance lies in its contribution to fundamental bacterial biology and its potential as a target for antibacterial interventions.
