Recombinant Crimean-Congo hemorrhagic fever virus Envelopment polyprotein (GP), partial (Active)

In Stock
Code CSB-MP810349CSC2
Abbreviation Recombinant Crimean-Congo hemorrhagic fever virus GP protein, partial (Active)
MSDS
Size $116
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CCHFV GP at 2 μg/ml can bind Anti-GP recombinant antibody (CSB-RA810349MA1CSC). The EC50 is 3.136-3.585 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CCHFV GP at 2 μg/mL can bind Anti-GP recombinant antibody (CSB-RA810349MA1CSC). The EC50 is 3.136-3.585 ng/mL.
Target Names
GP
Uniprot No.
Alternative Names
Envelopment polyprotein; M polyprotein; Mucin-like variable region; GP38; Glycoprotein NNon-Structural protein M; Glycoprotein C; GP
Species
Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) (CCHFV)
Source
Mammalian cell
Expression Region
1078-1439aa
Target Protein Sequence
KPTVSTANIALSWSSVEHRGNKILVSGRSESIMKLEERTGISWDLGVEDASESKLLTVSVMDLSQMYSPVFEYLSGDRQVGEWPKATCTGDCPERCGCTSSTCLHKEWPHSRNWRCNPTWCWGVGTGCTCCGLDVKDLFTDYMFVKWKVEYIKTEAIVCVELTSQERQCSLIEAGTRFNLGPVTITLSEPRNIQQKLPPEIITLHPRIEEGFFDLMHVQKVLSASTVCKLQSCTHGVPGDLQVYHIGNLLKGDKVNGHLIHKIEPHFNTSWMSWDGCDLDYYCNMGDWPSCTYTGVTQHNHASFVNLLNIETDYTKNFHFHSKRVTAHGDTPQLDLKARPTYGAGEITVLVEVADMELHTKK
Mol. Weight
42.2 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Crimean-Congo hemorrhagic fever virus (CCHFV) Envelopment polyprotein (GP) is the major surface glycoprotein that mediates viral attachment, membrane fusion and host cell entry, serving as the primary target for vaccine development, diagnostic assay design and antiviral therapeutic research against this highly pathogenic hemorrhagic fever virus. This mammalian-expressed partial construct spanning residues 1078–1439 carries a C-terminal 10×His tag for efficient purification, with a theoretical molecular weight of 42.2 kDa. Functional ELISA validation demonstrates specific binding to an anti-GP recombinant antibody (CSB-RA810349MA1CSC) with an EC50 of 3.136–3.585 ng/mL when immobilized at 2 μg/mL, confirming that the native conformational epitopes critical for antibody recognition are preserved. The quantified binding activity supports use in antibody development and validation workflows, including epitope mapping, competitive inhibition screening, and neutralizing antibody characterization for CCHFV research and countermeasure development. With >95% purity verified by SDS-PAGE and endotoxin levels below 1.0 EU/μg as determined by the LAL method, this lyophilized active protein meets the rigorous quality thresholds required for surface plasmon resonance affinity characterization, biolayer interferometry kinetic studies, and use as a positive control in CCHFV diagnostic assays and viral entry mechanism investigations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glycoprotein C and glycoprotein N interact with each other and are present at the surface of the virion. They are able to attach the virion to host cell receptors. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion.
Subcellular Location
[Glycoprotein C]: Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Glycoprotein N]: Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.
Protein Families
Nairovirus envelope glycoprotein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*