Recombinant Danio rerio Erythropoietin (epo)

^{In Stock}

Code	CSB-EP007743DIL
Abbreviation	Recombinant Zebrafish EPO protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

epo

Uniprot No.

Q2XNF5

Research Area

Cardiovascular

Alternative Names

epo; Erythropoietin; Erythropoietin-L2

Species

Danio rerio(Zebrafish)(Brachydanio rerio)

Source

E.coli

Expression Region

24-183aa

Target Protein Sequence

SPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

21.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene encoding the Danio rerio (Zebrafish) epo protein (24-183aa) creates recombinant plasmid, which is then transformed into e.coli cells. e.coli cells that can endure a specific antibiotic are selected and cultured under conditions that encourage the expression of the gene of interest. The protein features a N-terminal 10xHis tag fusion. Following expression, affinity purification is employed to isolate and purify the recombinant Danio rerio (Zebrafish) epo protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Danio rerio (Zebrafish) epo protein, indicating a purity level exceeding 85%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.

Gene References into Functions

The zebrafish epo cDNA was cloned and the expression of zepo mRNA was mainly in the heart and liver. PMID: 17706649
characterization of zebrafish epo and epor demonstrates the conservation of an ancient program that ensures proper red blood cell numbers during normal homeostasis and under hypoxic conditions PMID: 17579187

Subcellular Location

Secreted.

Protein Families

EPO/TPO family

Tissue Specificity

Expressed in heart and liver.

Database Links

KEGG: dre:100004455

STRING: 7955.ENSDARP00000100433

UniGene: Dr.11767

Promotions