Recombinant Danio rerio Erythropoietin (epo)

In Stock Promotion
Code CSB-EP007743DIL
Size US$388
Order now
Promotion
Promotional price as low as $99
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
epo
Uniprot No.
Research Area
Cardiovascular
Alternative Names
epo; Erythropoietin; Erythropoietin-L2
Species
Danio rerio(Zebrafish)(Brachydanio rerio)
Source
E.coli
Expression Region
24-183aa
Target Protein Sequence
SPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
21.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene encoding the Danio rerio (Zebrafish) epo protein (24-183aa) creates recombinant plasmid, which is then transformed into e.coli cells. e.coli cells that can endure a specific antibiotic are selected and cultured under conditions that encourage the expression of the gene of interest. The protein features a N-terminal 10xHis tag fusion. Following expression, affinity purification is employed to isolate and purify the recombinant Danio rerio (Zebrafish) epo protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Danio rerio (Zebrafish) epo protein, indicating a purity level exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Gene References into Functions
  1. The zebrafish epo cDNA was cloned and the expression of zepo mRNA was mainly in the heart and liver. PMID: 17706649
  2. characterization of zebrafish epo and epor demonstrates the conservation of an ancient program that ensures proper red blood cell numbers during normal homeostasis and under hypoxic conditions PMID: 17579187
Subcellular Location
Secreted.
Protein Families
EPO/TPO family
Tissue Specificity
Expressed in heart and liver.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*