Recombinant Dog Cationic trypsin

In Stock
Code CSB-EP361971DO
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P06871
Lead Time 3-7 business days
Relevance Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Canis lupus familiaris (Dog) (Canis familiaris)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN
Research Area others
Source E.coli
Protein Names Recommended name: Cationic trypsin EC= 3.4.21.4
Expression Region 24-246aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 39.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted, extracellular space
Protein Families Peptidase S1 family
Database Links

STRING: 9615.ENSCAFP00000005682

Related Products

Antibodies

Antibodies for Canis lupus familiaris (Dog) (Canis familiaris)

Proteins

Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.