Recombinant Dog Interleukin-18(IL18)

In Stock
Code CSB-EP895937DO
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q9XSR0
Lead Time 3-7 business days
Relevance Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Interferon gamma-inducing factor ;IFN-gamma-inducing factorInterleukin-1 gamma ;IL-1 gamma
Species Canis lupus familiaris (Dog) (Canis familiaris)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS
Research Area Others
Source E.coli
Gene Names IL18
Expression Region 37-193aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 22.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Subcellular Location Secreted
Protein Families IL-1 family
Database Links

KEGG: cfa:403796

STRING: 9615.ENSCAFP00000038185

UniGene: Cfa.40

Pathway Inflammasome Signaling
NOD-like receptor signaling pathway

Related Products

IL18 Antibodies

IL18 Antibodies for Dog

IL18 Proteins

IL18 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

IL18 ELISA Kit

IL18 ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.