Recombinant Escherichia coli S-ribosylhomocysteine lyase (luxS)

In Stock
Code CSB-EP541717ENT
Abbreviation Recombinant E.coli luxS protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
luxS
Uniprot No.
Research Area
Others
Alternative Names
luxS; ygaG; b2687; JW2662; S-ribosylhomocysteine lyase; EC 4.4.1.21; AI-2 synthesis protein; Autoinducer-2 production protein LuxS
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
2-171aa
Target Protein Sequence
PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Escherichia coli (strain K12) luxS was expressed with the amino acid range of 2-171. The calculated molecular weight for this luxS protein is 23.3 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis tag into the luxS encoding gene fragment was conducted, allowing for easier detection and purification of the luxS protein in subsequent stages.

Escherichia coli S-Ribosylhomocysteine Lyase (luxS) is a pivotal enzyme involved in the activated methyl cycle and quorum sensing processes. Its primary function involves catalyzing the conversion of S-ribosylhomocysteine, a byproduct of the activated methyl cycle, to homocysteine and 4,5-dihydroxy-2,3-pentanedione. In molecular microbiology, luxS is extensively studied for its involvement in quorum sensing pathways, shedding light on bacterial behavior and potential applications in modulating microbial communication for various purposes. LuxS plays a central role in the LuxS/AI-2 quorum sensing system. It is integral in bacterial communication, regulating gene expression in response to cell density.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the environment. The regulation of gene expression in response to changes in cell density is called quorum sensing. Catalyzes the transformation of S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD).
Gene References into Functions
  1. study demonstrated that luxS affects the expression of flagella and Stx2e toxin, 2 important STEC virulence factors PMID: 24848979
  2. LuxS contributes to virulence in avian pathogenic Escherichia coli O78:K80:H9. PMID: 23958403
  3. Proteomic profiling of luxS mutants showed only a few proteins were differentially expressed and those that were altered suggested a metabolic rather than communication role for the E. coli luxS gene product. PMID: 23651217
  4. Deletion of the luxS gene reduced the bacterial virulence by 31.5-fold in ducklings. PMID: 23046700
  5. Polyphosphate degradation in stationary phase triggers biofilm formation via LuxS quorum sensing system in Escherichia coli. PMID: 23226268
  6. Pfs and LuxS synthesize AI-2 in vitro from S-ribosylhomocysteine. PMID: 23236852
  7. luxS deletion significantly increases swimming motility and flagella synthesis in Escherichia coli K12. PMID: 20875395
  8. These data are consistent with the function of LuxS as an important metabolic enzyme but appear not to support the role of AI-2 as a true signal molecule for E. coli W3110 under the investigated conditions. PMID: 16321939
  9. The active form of LuxS contains a metal-bound water and a thiolate ion at Cys-83, consistent with the proposed roles of the metal ion (Lewis acid) and Cys-83 (general acid/base) during catalysis. PMID: 17014073

Show More

Hide All

Protein Families
LuxS family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*