Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
luxS; ygaG; b2687; JW2662; S-ribosylhomocysteine lyase; EC 4.4.1.21; AI-2 synthesis protein; Autoinducer-2 production protein LuxS
Species
Escherichia coli (strain K12)
Expression Region
2-171aa
Target Protein Sequence
PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Escherichia coli (strain K12) luxS was expressed with the amino acid range of 2-171. The calculated molecular weight for this luxS protein is 23.3 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis tag into the luxS encoding gene fragment was conducted, allowing for easier detection and purification of the luxS protein in subsequent stages.
Escherichia coli S-Ribosylhomocysteine Lyase (luxS) is a pivotal enzyme involved in the activated methyl cycle and quorum sensing processes. Its primary function involves catalyzing the conversion of S-ribosylhomocysteine, a byproduct of the activated methyl cycle, to homocysteine and 4,5-dihydroxy-2,3-pentanedione. In molecular microbiology, luxS is extensively studied for its involvement in quorum sensing pathways, shedding light on bacterial behavior and potential applications in modulating microbial communication for various purposes. LuxS plays a central role in the LuxS/AI-2 quorum sensing system. It is integral in bacterial communication, regulating gene expression in response to cell density.
