Recombinant Enterococcus faecalis Gelatinase (gelE)

In Stock
Code CSB-EP769310ELW
Abbreviation Recombinant Enterococcus faecalis gelE protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP769310ELW could indicate that this peptide derived from E.coli-expressed Enterococcus faecalis (strain ATCC 700802 / V583) gelE.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP769310ELW could indicate that this peptide derived from E.coli-expressed Enterococcus faecalis (strain ATCC 700802 / V583) gelE.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
gelE
Uniprot No.
Research Area
Others
Alternative Names
gelE; EF_1818Gelatinase; EC 3.4.24.30; Coccolysin
Species
Enterococcus faecalis (strain ATCC 700802 / V583)
Source
E.coli
Expression Region
193-510aa
Target Protein Sequence
VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYSSLVNYLTPKAQFSDARDAMLAAAKVQYGDEAASVVSAAFNSAGIGAKEDIQVNQPSESVLVNE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Enterococcus faecalis Gelatinase (gelE) gets expressed in E.coli and comes with an N-terminal 6xHis-SUMO tag that makes purification straightforward. The product appears to represent the full length of the mature protein, spanning amino acids 193-510. SDS-PAGE analysis confirms it reaches purity levels greater than 90%, which likely ensures minimal contamination for precise experimental outcomes. This product is strictly for research use only and should not be used in diagnostic or therapeutic applications.

Gelatinase from Enterococcus faecalis is a notable metalloprotease that breaks down gelatin and other proteins. Research suggests it's involved in bacterial virulence and biofilm formation. This makes it an important target for studying bacterial pathogenicity and antibiotic resistance mechanisms. The enzyme's ability to degrade extracellular matrix components may highlight its value in infectious disease research and microbial ecology studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant GelE protein are unknown and cannot be assumed. Gelatinase is a zinc-metalloprotease that requires precise folding around an active site and correct coordination of metal ions for catalytic activity. While the protein represents the mature enzyme sequence (193-510aa), its expression in E. coli with a large N-terminal 6xHis-SUMO tag creates significant uncertainty about its native conformation. The SUMO tag may enhance solubility but does not guarantee correct folding of the protease domain. Therefore, any application that depends on the protein's specific enzymatic activity or its properly formed substrate-binding site is speculative without experimental validation.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-SUMO tag allows this recombinant GelE to be immobilized for pull-down assays. However, the utility of these assays for identifying biological binding partners is entirely contingent on the protein being correctly folded. If the protein is misfolded, it may not present the correct binding interfaces, leading to the identification of non-specific interactors. Such experiments could be conducted, but results must be interpreted as preliminary and require confirmation with a validated, active protein.

2. Antibody Development and Immunoassay Applications

This recombinant GelE protein is suitable for use as an immunogen to generate specific antibodies. The mature protein sequence increases the likelihood that antibodies will recognize epitopes present in the native enzyme. However, it is important to note that antibodies generated will primarily recognize linear epitopes. Their ability to bind the natively folded, active gelatinase in Enterococcus faecalis cultures is not guaranteed and requires empirical validation (e.g., using culture supernatants from a gelE+ strain). The protein is excellent for developing ELISA assays to detect anti-GelE antibodies.

3. Biochemical Characterization and Substrate Specificity Studies

This purified recombinant GelE protein is a starting point for biochemical characterization. Studies on substrate binding site analysis and binding kinetics with potential substrates cannot be meaningfully performed without first confirming the protein's enzymatic activity. It should first perform a gelatin zymography or a fluorescence-based protease activity assay to confirm functionality. If active, then studies on kinetics, pH optimum, and substrate specificity can be pursued. The initial studies should focus on biophysical properties (e.g., thermal stability via differential scanning fluorimetry) that are independent of activity.

4. Comparative Proteomics and Evolutionary Studies

The recombinant GelE protein can serve as a reference standard for comparative studies. This application is valid for specific, non-activity-dependent comparisons. It is suitable as a standard for mass spectrometry-based identification or for comparing immunological reactivity across strains. However, it cannot be used for "comparing expression levels" of the active enzyme in different isolates, as the assay would detect immunoreactivity, not necessarily functional enzyme levels.

Final Recommendation & Action Plan

The immediate and essential first step is to experimentally validate the proteolytic activity of this recombinant GelE protein using a functional assay, such as gelatin zymography or a fluorescence-quenched substrate assay. The outcome of this test is critical and dictates all subsequent applications: a positive result would justify and enable functional studies in Applications 1 (interactions) and 3 (kinetics/substrate specificity). A negative result would limit its reliable use to Applications 2 (antibody production, with the caveat about native conformation recognition) and 4 (as a reference antigen for comparative immunology or MS). Therefore, the activity assay is a prerequisite before investing resources in binding or kinetic studies, as data generated without this confirmation would be uninterpretable. The SUMO tag can be cleaved off to assess its impact on activity and folding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I want to know whether CSB-EP769310ELW is active form of E. faecalis gelE

A:

We haven't tested its activity, so its activity is not guaranteed.
This is a full length of mature protein and we adopt affinity chromatography for purification, which is purified under a very mild condition, it's active theoretically.
We suggest you add 1 mM Ca ion when testing. For more details, please visit this read this reference article: https://www.jbc.org/article/S0021-9258(18)94069-X/pdf

Target Background

Function
Metalloprotease capable of the hydrolysis of insoluble hydrophobic substrates. Hydrolyzes azocoll and gelatin and, at a lower rate, soluble and insoluble collagens. Does not cleave short synthetic peptides. Preferentially hydrolyzes the 24-Phe-|-Phe-25 bond in the insulin B-chain, followed by the 5-His-|-Leu-6 bond. Inactivates endothelin-1, primarily by cleavage of the 5-Ser-|-Leu-6 and 16-His-|-Leu-17 bonds. Hydrolyzes the alpha chain of C3 to generate a C3b-like protein. Inhibits complement-mediated hemolysis and opsinization of bacteria. Hydrolyzes the insect antimicrobial peptide cecropin. Decreases the length of E.faecalis chains via the activation of autolysin. Degrades polymerized fibrin.
Gene References into Functions
  1. E. faecalis gelatinase requires C-terminal processing for full activation of protease activity. The processing site is likely to be between residues D304 and I305 and that it requires the Q306 residue. PMID: 17921295
Subcellular Location
Secreted.
Protein Families
Peptidase M4 family
Database Links

KEGG: efa:EF1818

STRING: 226185.EF1818

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*