Very nice to receive your inquiry. As for the  difference between  N-terminal and C-terminal Tag, the EP protein has already been developed successfully, the tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged
The complete sequence of CSB-EP314742ENV including the tag sequence, any linker sequence and target protein sequence is list as below: 
MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSEFHHHHHHHHHHLVPRGSRT
+Target protein sequence: 
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
+
AAAEQKLISEEDL
The sequence before target protein sequence is N-terminal tag sequence, and after is C-terminal tag sequence.
The detailed explanation for the complete sequence:
S-Tag:  KETAAAKFERQHMDS
10xHis: HHHHHHHHHH
Thrombin site: LVPRGS
Linker: RT
Myc-Tag: EQKLISEEDL
This EP protein has been ordered several times by other cutomers, we received the feedback from some customer that he performed the MALDI-TOF identification for this protein, which proves the Mw is correct.The COA of the previous Lot is available upon your request. 
The other three proteins are semi-customized proteins that haven't been expressed before, Tag type will be determined during the manufacturing process. 
So we can't provide the complete sequence, we can only inform the target protein sequence, and also can't provide further clarification about the tag.
If the customer has desired tag for the YP, BP or MP proteins, you can communicate with us in advance, we can try to express the protein with you desired tag. 
If it's failed, we can provide the protein with other tag.