Recombinant Escherichia coli Cytidylate kinase (cmk)

In Stock
Code CSB-EP363865ENV
Abbreviation Recombinant E.coli cmk protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
cmk
Uniprot No.
Research Area
Others
Alternative Names
cmk; mssA; ycaF; ycaG; b0910; JW0893; Cytidylate kinase; CK; EC 2.7.4.25; Cytidine monophosphate kinase; CMP kinase; Protein MssA; p25
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
1-227aa
Target Protein Sequence
MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLALA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.7kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of this Recombinant E.coli cmk protein started with the cmk gene synthesis. And then using recombinant DNA technology, the cmk gene was inserted into an expression vector so that we could get the recombinant express plasmid of cmk. Transform the plasmid into the cells of E.coli, culture the cells and we could get the desired Recombinant E.coli cmk protein. But the work was not completed, protein purification and a strict QC system were performed in the last step. The purity is 90%+ determined by SDS-PAGE.

cmk (also called mssA, ycaF or ycaG) is a gene providing an instruction of making a protein named cytidylate kinase (CK) in Escherichia coli. The protein encoded by this gene is also known as cytidine monophosphate kinase (CMP kinase), protein MssA or p25. This protein is specific for CMP and dCMP and catalyses reversible transfer of the γ-phosphoryl group from a nucleoside triphosphate, generally ATP. It is involved in nucleobase-containing small molecule interconversion and pyrimidine nucleotide metabolic process.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.
Gene References into Functions
  1. analysis of of single amino acid substitutions in the pyrimidine base binding pocket of Escherichia coli CMP kinase PMID: 17542990
  2. Data show a molecular dynamics simulation on the CMK dimer complex, and protein-protein interactions. PMID: 19198899
Subcellular Location
Cytoplasm.
Protein Families
Cytidylate kinase family, Type 1 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*