Recombinant Escherichia coli Ferric uptake regulation protein (fur)

Code CSB-YP364302ENV
Abbreviation Recombinant E.coli fur protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
fur
Uniprot No.
Research Area
Microbiology
Alternative Names
fur; b0683; JW0669Ferric uptake regulation protein; Ferric uptake regulator
Species
Escherichia coli (strain K12)
Source
Yeast
Expression Region
2-148aa
Target Protein Sequence
TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a global negative controlling element, employing Fe(2+) as a cofactor to bind the operator of the repressed genes. Regulates the expression of several outer-membrane proteins including the iron transport operon.
Gene References into Functions
  1. The influence of oxygen availability on the levels of active Fur adds a previously undescribed layer of regulation in maintaining cellular iron homeostasis in E. coli. PMID: 29087312
  2. High iron supply inhibits the synthesis of the genotoxin colibactin by pathogenic Escherichia coli through a non-canonical Fur/RyhB-mediated pathway. PMID: 28637194
  3. Finally, Fur derepression and RecA activation in enterohemorrhagic Escherichia coli O157 were shown to participate in the nitric oxide-enhanced Stx1 and Stx2 production, respectively. PMID: 28294553
  4. The authors report that O2 availability affects the gene expression programs of two Escherichia coli master regulators that function in iron homeostasis: the transcription factor Fur and the small RNA regulator RyhB. PMID: 26670385
  5. The key regulator of the response to serum-active and inactive-is the iron regulator Fur, which controls the expression of more than 80% of the serum-upregulated genes. PMID: 25118243
  6. Fur exhibits a comprehensive regulatory role affecting many fundamental cellular processes linked to iron metabolism in order to coordinate the overall response of E. coli to iron availability. PMID: 25222563
  7. Authors demonstrated that the EHEC lpf2 operon is regulated in response to temperature, pH, bile salts and iron, during the exponential phase of growth, and is controlled by Fur. PMID: 24966050
  8. In a murine model of urinary tract infection (UTI), deletion of fur alone did not attenuate virulence, whereas a DeltaryhB mutant and a Deltafur DeltaryhB double mutant showed significantly reduced bladder colonization. PMID: 25245805
  9. There is a transient change in the activity of the iron regulator Fur and of the oxidative stress regulator SoxS after Zn addition. PMID: 22016571
  10. results presented here show that ftnA iron induction is independent of RyhB and instead involves direct interaction of Fe(2+)-Fur with an 'extended' Fur binding site (containing five tandem Fur boxes) located upstream (-83) of the ftnA promoter. PMID: 20015147
  11. H2O2-inducible antioxidant defense system leading to an increase in catalase; hydroperoxidase HPI activity, is unaltered in Deltafur mutants PMID: 15878120
  12. Tyr 55 of Escherichia coli Fur, as well as the two thymines in positions 18 and 19 of the consensus Fur Box, are involved with binding. PMID: 16212958
  13. Affinity of Fur for different metals was determined & ranges over several orders of magnitude in the order: Zn(II)>> Co(II)> Fe(II)> Mn(II). Only Fe(II) binds with sufficient affinity to activate Fur significantly at physiological metal levels. PMID: 16216078
  14. an activation mechanism for E. coli Fur involves the folding/unfolding of the N-terminal helix PMID: 16690618
  15. Fur protein translation is coupled to that of an upstream open reading frame, translation of which is downregulated by the non-coding RNA RyhB. PMID: 17268550
  16. Fur function may be antagonized by intracellular H2O2 by oxidizing the Fur:Fe(2+) complex and inactivating repressor function. PMID: 17462026
  17. In this study, information theory was used to identify new Fur binding sites, 13 of which we confirmed experimentally. PMID: 17921503
  18. In the fur+ strain compared to those in the fur- strain, expression of chromosomal dihydroorotase activity and beta-galactosidase activity of pyrC-lacZ fusion plasmid was repressed to about 30% and 17%, respectively. PMID: 18176545
  19. The characteristic metabolism of rpoS mutants required the activity of Fur (ferric uptake regulator) in order to decrease the synthesis of the small RNA RyhB that might otherwise inhibit the synthesis of iron-rich proteins. PMID: 18556786
  20. Binding of both zinc and iron ions induced a similar change in Fur conformations, but shifted residues closer to DNA in a different manner. PMID: 19023664
  21. transcriptomic data identified the global transcription regulators ArcA, CRP, Fis, FNR, Fur, BaeR, CpxR, and IHF as targets and potential CO sensors PMID: 19091747

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Fur family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*