Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A(ghrA)

Code CSB-EP482379ENMe1
Product Type Recombinant Protein
Size US$2632
Uniprot No. B7LFE3
Relevance Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 2-ketoacid reductase
Species Escherichia coli (strain 55989 / EAEC)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY
Research Area others
Source E.coli
Gene Names ghrA
Expression Region 1-312aa
Tag Info Tag-Free
Mol. Weight 35.4kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.
Subcellular Location Cytoplasm
Protein Families D-isomer specific 2-hydroxyacid dehydrogenase family, GhrA subfamily
Database Links

KEGG: eck:EC55989_1146

Related Products

ghrA Antibodies

ghrA Antibodies for Escherichia coli

ghrA Antibodies for Escherichia coli (strain 55989 / EAEC)

ghrA Proteins

ghrA Proteins for Escherichia coli (strain 55989 / EAEC)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.